ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_089830 ()

eukaryotic translation initiation factor 3 delta subunit, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11180

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • MAL7P1.81 eukaryotic translation initiation factor 3 37.28 kDa subunit, putative
  • PBANKA_061450 eukaryotic translation initiation factor subunit, putative
  • PY00595 eukaryotic translation initiation factor 3 39 kDa subunit
  • PVX_000590 eukaryotic translation initiation factor 3 subunit 2, putative
  • PCHAS_061620 eukaryotic translation initiation factor subunit, putative
  • PKH_030170 eukaryotic translation initiation factor
  • TGME49_089830 eukaryotic translation initiation factor 3 delta subunit, putative
  • NCLIV_042070 hypothetical protein
  • cgd5_680 eukaryotic translation initiation factor 3 37.28 kDa subunit, putative
  • Chro.50323 eukaryotic translation initiation factor 3 37.28 kDa subunit
  • CMU_041240 hypothetical protein, conserved
  • TP01_1092 eukaryotic translation initiation factor 3 subunit 2, putative
  • TA16275 eukaryotic translation initiation factor 3 (eIF3), subunit, putative
  • BBOV_IV003330 translation initiation factor 3 subunit 2
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_089830 eukaryotic translation initiation factor 3 delta subunit, putative
MRPLFLMGHARPLTWVTFNRDGDLLFTCGKDARLAVWFSENGERIGTYDCGKGVVWNCDCTLDSKRLICASADQKVMIFD
VCTGAIIHEIPEGGPCKFVEWNRKPGEQNKFVVVHDAFGSQSTKAIKVWELDGPNGKPRRLWSQDDYASRCVQVRWGPYD
QTIISCHENGDIMIWNAETGEYINEFRGHKQFITCLSFSDDRLLMLSSCSDGSAKLWDTIDFKCLKTYQTDRPLNACGIS
PRFNKAGEERKCHVMLGGGQAAEDVTTTASGEGKFEALIYHMVYQEELGSCKGHFGPLNTLCWMPDGNGYASGGEDGYVR
IYHFDEPYFTDKFEP

Gene-Specific Links for TGME49_089830

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins