ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_089800 ()

transmembrane trafficking protein, transmembrane protein Tmp21 precursor, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11157

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • MAL13P1.171 transmembrane protein Tmp21 homologue, putative
  • PBANKA_134800 transmembrane protein Tmp21 homologue, putative
  • PY06414 transmembrane protein tmp21 precursor
  • PVX_082595 hypothetical protein, conserved
  • PCHAS_135260 transmembrane protein Tmp21 homologue, putative
  • PKH_121960 transmembrane protein Tmp21 homologue, putative
  • TGME49_089800 transmembrane trafficking protein, transmembrane protein Tmp21 precursor, putative
  • NCLIV_042050 hypothetical protein
  • cgd1_430 possible emp24/gp25L/p24 family protein, transmembrane domain
  • CMU_035110 hypothetical protein
  • TP02_0330 hypothetical protein
  • TA12565 cargo protein (transmembrane protein tmp21 homologue), putative
  • BBOV_III006340 membrane protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_089800 transmembrane trafficking protein, transmembrane protein Tmp21 precursor, putative
MSVSQLTASRRSSRGSRGLCSCPRSFLLFALGLGLASLALTPPAAAFQAVIELAPGQKRCVGEQLSRHVLVVGEFHIAYP
AAATAQGGNMLVVAEDPVSHSPIFKQQGKDHVRTAFTTALTGTHTFCVTNTGRLKLAVDFKMVWGPEARDYSQIAKAEHL
DEVMVQLLRLQDRLKLYHANVLYMREKESKMREASDSTANRLMTFCLVNMMLLVLAALASAYYFKRFFRSKKII

Gene-Specific Links for TGME49_089800

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins