ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_089770 (AP-1 u1 chain, µ1)

mu1 adaptin, a gene from Toxoplasma gondii

Compiled localisation
vesicle
golgi apparatus and limiting membrane of rhoptry and luminal membrane of rhoptry and multi-vesicular endosome and trans-golgi network during tachyzoite

Who localised this protein by microscopy?

Breinich, M. S., Ferguson, D. J., Foth, B. J., van Dooren, G. G., Lebrun, M., Quon, D. V., Striepen, B., Bradley, P. J., Frischknecht, F., Carruthers, V. B., Meissner, M.
A dynamin is required for the biogenesis of secretory organelles in Toxoplasma gondii. (2009 Feb 24, Curr Biol) PubMed / full text
   more detail about this publication

vesicle
  • "We were not able to colocalize DrpB with markers of the secretory pathway, such as the cis-medial Golgi marker GRASP-RFP [20], the trans-Golgi marker UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase T1 fused to yellow fluorescent protein (YFP) (TgGalNac-YFP; M. Nishi and D.S. Roos, personal communication) [4], the propeptide of M2AP (a precursor microneme protein that localizes in endosome-related compartments) [4], VP-1 (a vacuolar proton pyrophosphatase) [4], or the μ1 chain of the adaptin-1 complex 3."
  • Microscopy type: Light
  • Microscopy method: Ty tag
  • Strain: RH hxgprt−
  • Gene model mapping comments: inferred from another publication
  • Localisation record: vesicles
  • Other genes localised in this publication: dynamin-like protein, putative, H+-translocating inorganic pyrophosphatase TVP, putative, MIC2-associated protein M2AP, microneme protein 8

Ngo, H. M., Yang, M., Paprotka, K., Pypaert, M., Hoppe, H., Joiner, K. A.
AP-1 in Toxoplasma gondii mediates biogenesis of the rhoptry secretory organelle from a post-Golgi compartment. (2003 Feb 14, J Biol Chem) PubMed / full text
   more detail about this publication

golgi apparatus and limiting membrane of rhoptry and luminal membrane of rhoptry and multi-vesicular endosome and trans-golgi network during tachyzoite
  • "The T. gondii AP-1 adaptin complex is implicated in this transport because the micro1 chain of T. gondii AP-1 (a) was localized to multivesicular endosomes and the limiting and luminal membranes of the rhoptries; (b) bound to endocytic tyrosine motifs in rhoptry proteins, but not in proteins from dense granule secretory organelles; (c) when mutated in predicted tyrosine-binding motifs, led to accumulation of the rhoptry protein ROP2 in a post-Golgi multivesicular compartment; and (d) when depleted via antisense mRNA, resulted in accumulation of multivesicular endosomes and immature rhoptries. ... Tgµ1 is predominantly localized to the Golgi/TGN as indicated by immunofluorescence microscopy."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein, HA tag
  • Strain: RH
  • Gene model mapping comments: Blast from AY117037.1, annotation matches
  • Localisation record: multi-vesicular endosome and limiting membrane of rhoptry and luminal membrane of rhoptry and TGN and golgi during tachyzoite
  • Other genes localised in this publication: Rhoptry kinase family protein ROP2A (incomplete catalytic triad)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10944

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_089770 mu1 adaptin
MAGASAVFILDLKGKVIISRDYRGNVSLASAAERFQQNVVELDDPLLIKPIFLEDGVTYAWIQYSNVYLLAVTRRNSNAM
MLLSFLYKLSEVLQEYFKALEEESIRDNFVITYELLDEVMDNGFPQSTEVKVLREFIKNEAHQLSVDALRPPTAMTNAVS
WRSEGIFHKKNEVFLDVVEKLNLLVSSNGTVLRSEILGSLKMKSFLSGMPELKLGLNDKLLLETSGRTVSKGKAIEMEDI
KFHQCVRLARFENDRTISFIPPDGEFELMSYRLNTQVKPLIWIDAVVDTGRSATRIEFMIKARSQFKSRSVASGVEIHVP
VPPDADSPHFKTSIGSVKYLPEKDTMVWFIKQFQGQRDFVMTATFGLPSVGVEARDAYLKKPINVKFEIPYFTVSGITVR
YLKIIEKSGYQALPWVRYITQNGEYQLRLS

Gene-Specific Links for TGME49_089770

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins