ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_089750 ()

ubiquitin / ribosomal protein CEP52 fusion protein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11404

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF13_0346 60S ribosomal protein L40/UBI, putative
  • PBANKA_114170 60S ribosomal protein L40/UBI, putative
  • PVX_115255 ubiquitin/ribosomal, putative
  • PCHAS_114120 60S ribosomal protein L40/UBI, putative
  • PKH_110480 ubiquitin/ribosomal fusion protein uba52 homologue, putative
  • TGME49_089750 ubiquitin / ribosomal protein CEP52 fusion protein, putative
  • NCLIV_042000 ubiquitin / ribosomal protein CEP52 fusion protein, putative
  • cgd7_2280 60S ribosomal protein L40
  • Chro.70260 ubiquitin / ribosomal protein CEP52
  • CMU_034330 60S ribosomal protein L40, putative
  • TP01_1070 ubiquitin/ribosomal fusion protein, putative
  • TA16165 ubiquitin/60S ribosomal fusion protein, putative
  • BBOV_IV003190 ubiquitin / ribosomal protein CEP52
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_089750 ubiquitin / ribosomal protein CEP52 fusion protein, putative
MQIFVKTLTGKTITLDVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEP
SLALLAQKYNCEKKVCRKCYARLPPRATNCRKKKCGHSNQLRPKKKPKN

Gene-Specific Links for TGME49_089750

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins