ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_089680 (Rab11, Rab11A)

Ras family domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation
rhoptry and vesicle during intracellular tachyzoite
posterior

Who localised this protein by microscopy?

Agop-Nersesian, C., Naissant, B., Ben Rached, F., Rauch, M., Kretzschmar, A., Thiberge, S., Menard, R., Ferguson, D. J., Meissner, M., Langsley, G.
Rab11A-controlled assembly of the inner membrane complex is required for completion of apicomplexan cytokinesis. (2009 Jan, PLoS Pathog) PubMed / full text
   more detail about this publication

rhoptry and vesicle during intracellular tachyzoite

Bradley, P. J., Ward, C., Cheng, S. J., Alexander, D. L., Coller, S., Coombs, G. H., Dunn, J. D., Ferguson, D. J., Sanderson, S. J., Wastling, J. M., Boothroyd, J. C.
Proteomic analysis of rhoptry organelles reveals many novel constituents for host-parasite interactions in Toxoplasma gondii. (2005 Oct 7, J Biol Chem) PubMed / full text
   more detail about this publication

posterior and rhoptry

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10424

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_089680 Ras family domain-containing protein
MAAKDEYYDYLYKIVLIGDSGVGKSNMLSRFTRDEFNLESKSTIGVEFATKSVYLDEGKVIKAQIWDTAGQERYRAITSA
YYRGAVGALLVYDITKRQSFENVERWLKELRDHADPNIVILLVGNKSDLKHLRAVSVEEATKFANREHLAFIETSALDAT
NVEQAFHQILAEIYLLRQKKQIEDNPQSTTQPGRGQKIHLDEERTDSQIRQSRRGCCSA

Gene-Specific Links for TGME49_089680

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins