ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_089650 (PEP-carboxykinase I)

phosphoenolpyruvate carboxykinase, a gene from Toxoplasma gondii

Compiled localisation
cytosol during tachyzoite

Who localised this protein by microscopy?

Fleige, T., Pfaff, N., Gross, U., Bohne, W.
Localisation of gluconeogenesis and tricarboxylic acid (TCA)-cycle enzymes and first functional analysis of the TCA cycle in Toxoplasma gondii. (2008 Aug, Int J Parasitol) PubMed / full text
   more detail about this publication

cytosol during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11850

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF13_0234 phosphoenolpyruvate carboxykinase
  • PBANKA_135590 phosphoenolpyruvate carboxykinase, putative
  • PY01233 phosphoenolpyruvate carboxykinase
  • PVX_083035 phosphoenolpyruvate carboxykinase , putative
  • PCHAS_136050 phosphoenolpyruvate carboxykinase, putative
  • PKH_121170 phosphoenolpyruvate carboxykinase, putative
  • NCLIV_041900 Phosphoenolpyruvate carboxykinase (ATP) (EC 4.1.1.49), related
  • TP01_0495 phosphoenolpyruvate carboxykinase, putative
  • TA20590 phosphoenolpyruvate carboxykinase, putative
  • BBOV_I003550 phosphoenolpyruvate carboxykinase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_089650 phosphoenolpyruvate carboxykinase
MNYTMHLSRNVLREVYRFLPGRGFLPAQGSTASRVRHSLADKEFPCCSRSETCGLHIAEVRHTFFRQLRGSSGVNRKSSD
AQRQFVVQFSRSVRKMNRTQSSGSLKDSISFLEMLKKQIDANLQHHKPGDCPLTKKDILDLGQLQKEIDFQENVQAVGIT
CAQLFHNTAPSVLYEQALKKEAGSLIASSGALCVSSGLKTGRSPADKRIVEEPSSRDDVWWGKVNIPFCEKSYLVNRERA
VDYLNLQDQLYIVDAFAGWDPEYRIKIRVITTRAYHALFMQNMLVMPTAEELENFRPDFTIYNAGCFPANRFTNGVTSQT
SVAMNLGAGEMVILGTQYAGEMKKGILTLMMYLMPKRGQLPLHSSCNVGPKGDVTLFFGLSGTGKTTLSADPSRQLIGDD
EHVWTDKGVFNIEGGCYAKCKDLSKEQEPEIWNAIRFGSVLENVIIDGTTRVVDFRDVSITENTRCAYPLSFIPNALLPA
KVDTHPSNIILLTCDAFGVLPPLSKLTPDQVMYHFISGYTSKMAGTEIGILEPTATFSACYGAPFLAMHPMVYAEMLAKK
LKEHNAHAWLLNTGWICGGYGMNEGRRIPLKYTRLMVDAIHNGAALQTEYQTMPVFNLAVPTAINGVPSDLLLPQTCWAD
QNKLDKQMRKLASLFVENFSNYTDRATPNVVAAGPVF

Gene-Specific Links for TGME49_089650

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins