ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_089630 (MIC16)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
apical during tachyzoite
microneme during intracellular tachyzoite

Who localised this protein by microscopy?

Sheiner, L., Santos, J. M., Klages, N., Parussini, F., Jemmely, N., Friedrich, N., Ward, G. E., Soldati-Favre, D.
Toxoplasma gondii transmembrane microneme proteins and their modular design. (2010 Jun 9, Mol Microbiol) PubMed / full text
   more detail about this publication

microneme during intracellular tachyzoite
  • "Transient expression of this new protein carrying a Ty epitope at the C-terminus revealed a micronemal localization in T. gondii tachyzoites (Fig. 2B)."
  • Microscopy type: fixed light
  • Microscopy method: antibody to Ty tag
  • Strain: RH hxgprt-
  • Gene model mapping comments: taken directly from 20545864
  • Localisation record: microneme during intracellular tachyzoite
  • Other genes localised in this publication: microneme protein MIC4, dense granule protein 3, gorasp2-prov protein

Chen, Z., Harb, O. S., Roos, D. S.
In silico identification of specialized secretory-organelle proteins in apicomplexan parasites and in vivo validation in Toxoplasma gondii. (2008, PLoS One) PubMed / full text
   more detail about this publication

apical during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115417

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_089630 hypothetical protein
MVVSCLCTAMSSALSQRNCILISCRLGRQRSRPPDAMKVYAPVFTCRRQFLYEKYTRRRCTTLGGLVALCVIFTAEAISR
SQHPYGTSRSDLSPPATVDSTSYGMSILEAGGPSDEVAIPSDRLQTFRNASLDFDRAIRFPNQASVAESRQLRLMQMGEC
QNVYWGKKELISRITGKWKSALHPSCHESWFTYTSWSRTKTWRECAQALDNSYLYFSWVRRHNEADGACIWVKPSRRDVS
KSDVEDCLVDVNPQKEVAVTGIVGSHHGCTTCEVGEWSETTCDSWCNDGVKGRFRELTGHTNSAHCSTSADANCDVCPNL
WEVQRCSTAVECAQGIKPRVRFCPNEGREYTAEGWRACAERCQRKFNATNGDTANRDTFYKAECFRYSFNNDTSACILNP
LHACPDAESASDVLWISGDVLSMPSADYTTVTWQEWQSWSSCSEVDPATGWKKRTRRPKTWGYRPDNVLSPLQWISVTPC
ASNVTLTRSELDLAMNPSAMCWVYSDFADWSTVSCEPRCGADRKKTRARAVRQMPVVQPDGRISESCASTEVSLEARQQT
KDCPGFVSCGTGCVFGEWTAWSDCRCTAEGSTARTIRARELVSGSKESCTGLEEERKCEKVCEESIFSNGVTYAVAGGIG
LVVVIGLGFIGRKFYRALPAERTRDNYL

Gene-Specific Links for TGME49_089630

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins