ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_089620 (CPC1) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

cathepsin C, a gene from Toxoplasma gondii

Compiled localisation
dense granule during tachyzoite

Who localised this protein by microscopy?

Que, X., Engel, J. C., Ferguson, D., Wunderlich, A., Tomavo, S., Reed, S. L.
Cathepsin Cs are key for the intracellular survival of the protozoan parasite, Toxoplasma gondii. (2007 Feb 16, J Biol Chem) PubMed / full text
   more detail about this publication

dense granule during tachyzoite
  • "TgCPC1 and TgCPC2 localize to constitutive secretory vesicles of tachyzoites, the dense granules."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from DQ063593.1, gene model inconsistent, annotation matches
  • Localisation record: dense granule during tachyzoite
  • Other genes localised in this publication: cathepsin C2 (TgCPC2)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13781

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_089620 cathepsin C
MEGMGSLRRRCAALPLVAGFLVFLGSIGVKADLPIHATVHDIKGDWTFYLSPAVPGDVSNCGSPSPNTNTSNLREELKDY
KSFLSTQGGIKKELRVSLTDIPVSFATTRTAAALENPHRRTWKTLGVFDGQDKRKLVGSWTTVYDEGFEVDVGGRMRLMG
FMKYNPQNNCSIVDGDLENSQGITDCYATDPTRTQIGWYIQQAEDGSRLSGCFYAEKPKAASSTPAAFVAIKETTRVEPA
SGALIGTDLKDSTSYISQSFVDTHNASPASSWRAGVNSVFANMNRRDLSRFVKDFGFKKMRPAGDSADGLSFMQSSTDIS
TADGDAASTQVYACPCKKGERSLDTRKLDESEQTLEVLSPVSALEVGHTNFLAAINPHVHESTATNGLDAQGTQAVAKAA
LSGAGATNTQEPLLLPKDFSWSDPFSNQAFDETVTNQGSCGSCYAVAATYALQKRFEIAASRMLGQEIRLFSAVQDEADG
ALSFLDLGSTSQLGELSAQSILSCSFYNQGCDGGFPYLVGKHARDIGVPQARCMEYQADHTQGCPFQKTASASESQSMLQ
ADANAGACSEHARWYAKDYGYIGGCYECNHCSGEKQIMLEIYNNGPVPVAFDAPPSLFSYRSGVYDANSNHARVCDNDLP
HHTGILTGWEYTNHAVTIVGWGETDGENGKPQKYWIVRNTWGPNWGVDGYVKIARGKNLGGIESQATFIDPDFSRGQGLK
VAKAIEALKSKTM

Gene-Specific Links for TGME49_089620

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins