ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_089600 (Hsp29)

Hsp20/alpha crystallin domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation
parasite plasma membrane during bradyzoite and tachyzoite

Who localised this protein by microscopy?

de Miguel, N., Echeverria, P. C., Angel, S. O.
Differential subcellular localization of members of the Toxoplasma gondii small heat shock protein family. (2005 Dec, Eukaryot Cell) PubMed / full text
   more detail about this publication

parasite plasma membrane during bradyzoite and tachyzoite
  • "Double immunofluorescence assays employing anti-Hsp29 antibodies and a monoclonal antibody directed against anti-P30, a surface protein, indicated a membrane-associated localization of this protein in tachyzoite and bradyzoite stages"
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: PK
  • Gene model mapping comments: blast from AY721614, annotation does not match
  • Localisation record: membrane during tachyzoite
  • Other genes localised in this publication: small heat shock protein 20, heat shock protein 28, small heat shock protein 21
  • "Our data provide clear evidence that Hsp29 protein is associated to the membrane of the parasite, in the tachyzoite as well as in the bradyzoite stage."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: ME49
  • Gene model mapping comments: inferred from another publication
  • Localisation record: membrane during bradyzoite
  • Other genes localised in this publication: small heat shock protein 20, heat shock protein 28, small heat shock protein 21

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10315

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_089600 Hsp20/alpha crystallin domain-containing protein
MADSSGPGDARVAQRVTTIPGGTTTTTKTTTYTIRSVPVTTTTSSFAASSCGTTTGPTTSATDFAFDDLKRYLEDHGKMI
LEDPRTKHLIASGQATWEDVKRYLDSRAPPTHLAEGSSVVYSTTGGYWYPVVAGMPGVAAPSTIFEVGPGSAEICNKISF
RPRLDAYYDANRNRLVLLFDLPGFEKKDVEIELDKGALAISGERPKLEESKLGQDCNNIIKERSFGFFYRKFQLPGNAEE
ESIKASMEQGVLEVTIGLKDENQPTKKKIDVQ

Gene-Specific Links for TGME49_089600

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins