ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_088830 (NDH2-II)

pyridine nucleotide-disulphide oxidoreductase, putative, a gene from Toxoplasma gondii

Compiled localisation
mitochondrion during bradyzoite and tachyzoite

Who localised this protein by microscopy?

Lin, S. S., Kerscher, S., Saleh, A., Brandt, U., Gross, U., Bohne, W.
The Toxoplasma gondii type-II NADH dehydrogenase TgNDH2-I is inhibited by 1-hydroxy-2-alkyl-4(1H)quinolones. (2008 Nov, Biochim Biophys Acta) PubMed / full text
   more detail about this publication

mitochondrion during bradyzoite and tachyzoite
  • "TgNDH2-I and TgNDH2-II are constitutively expressed in tachyzoites and bradyzoites and are localized to the mitochondrion as shown by epitope tagging."
  • Microscopy type: Light
  • Microscopy method: myc tag
  • Strain: RH
  • Gene model mapping comments: blast from DQ228957.1
  • Localisation record: mitochondria during tachyzoite and bradyzoite
  • Other genes localised in this publication: mitochondrial alternative NADH dehydrogenase 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10452

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_088830 pyridine nucleotide-disulphide oxidoreductase, putative
MAMLFSSSAAGSLPSRRSRSVAAKLAPFASPIFSSPLLKQGADTAFGLRSPTPGLSVHPRFASRGPLTRSEEAGKAPFGF
STARGEQTATETNAPRFGTSLCSSFPLSATQKSHGSREKGLTNERAFSTFSFQGFMKNVKSRNAKPYTGPPQKVVVLGTG
WASVNFFRHLDPNIYDVTVISPRNYFTFTPLLPSVCAGTLSPLSCIEPVRSLTYRNGRKVADFYEAHCTDVDFKNRIVAC
DSRQGGHFKVKYDYLVIAVGSESNTFGIKDVAANAFFLKEVEHAMAIRKKVMNNFELAALPQTSEKERDRLLHFVVVGGG
PTGVESAAEFADFIKEDMSKYFPQLIPHVSISLIEGGSRLLGTYPPDISAFAEKTLTEELHVKLLLRSTVVGVDATSVRY
VSNEPGASKEPKELLHGFVLWASGVGEVPLVKKIIAENFPNVEGKPRLRGLPVDAQLRLLNQPNVYALGDCAAIAPPRLA
DAAQELFSKAGAAEPTPQWLGRHAPTLAQQFPQLSPLKFNFAKLQSNEHLPADQFKSFLAEIDAAYRPPAPTAQNARQEG
IYLAKVFNECPHPEEKADAPAFQETWNGSLAYVGSGQAVAHLPYFNIKGGFLSLPFWKAVYTQMQITWRSRTICLFDWLK
TFFAGRDVGRDHEYYNH

Gene-Specific Links for TGME49_088830

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins