ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_088750 ()

ubiquinol-cytochrome C reductase complex 14 kDa protein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_23868

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF10_0120 ubiquinol-cytochrome c reductase complex subunit, putative
  • PBANKA_121070 ubiquinol-cytochrome c reductase complex subunit, putative
  • PY03477 hypothetical protein
  • PVX_094835 ubiquinol-cytochrome c reductase, putative
  • PCHAS_121140 ubiquinol-cytochrome c reductase complex subunit, putative
  • PKH_081180 hypothetical protein, conserved in Apicomplexan species
  • TGME49_088750 ubiquinol-cytochrome C reductase complex 14 kDa protein, putative
  • NCLIV_041210 Ubiquinol-cytochrome c reductase complex 14 kDa protein, putative
  • TP01_0860 ubiquinol-cytochrome C reductase complex 14kD subunit
  • TA06055 ubiquinol-cytochrome C reductase complex, 14 kDa subunit homologue, putative
  • BBOV_IV009120 conserved hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_088750 ubiquinol-cytochrome C reductase complex 14 kDa protein, putative
MAQFHREIGKLFASYSNKITANSPVQYVPSPPTKGKVRRALSSALMPVWFKFFRGPLDRWNLAVMAKYLRDHGLMYDDLY
SDKEPVFARALELLPPDIQAARFRRLMRGTYLNHLRLYLPVHEQNYDPFIPYMAPYVEEAKFQLQEEEELLGYHMWEGVW
YSGGVTGFGDKEPGEHFLVALPNLYGAGGSPMQAGGKHFSSHAASAARARLATLAQKRLEEAMQQRERQSVSQN

Gene-Specific Links for TGME49_088750

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins