ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_088680 (APN)

endonuclease V, putative, a gene from Toxoplasma gondii

Compiled localisation
nucleus during intracellular tachyzoite

Who localised this protein by microscopy?

Onyango, D. O., Naguleswaran, A., Delaplane, S., Reed, A., Kelley, M. R., Georgiadis, M. M., Sullivan, W. J. Jr
Base excision repair apurinic/apyrimidinic endonucleases in apicomplexan parasite Toxoplasma gondii. (2011 May 5, DNA Repair (Amst)) PubMed / full text
   more detail about this publication

nucleus during intracellular tachyzoite
  • "Native TgAPE is present in the parasite nucleus and cytoplasm while native TgAPN is nuclear (Fig. 2B)."
  • Microscopy type: fixed light
  • Microscopy method: antibody directly to protein, FLAG tag
  • Strain: RH
  • Gene model mapping comments: blast from HM593514, taken directly from publication
  • Localisation record: nucleus during intracellular tachyzoite
  • Comment: GenBank sequence not yet released, even though the article is fully published
  • Other genes localised in this publication: DNA-(apurinic or apyrimidinic site) lyase, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12949

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF13_0176 apurinic/apyrimidinic endonuclease Apn1, putative
  • PBANKA_134740 apurinic/apyrimidinic endonuclease, putative
  • PY05725 AP endonuclease 1
  • PVX_082560 apurinic/apyrimidinic endonuclease Apn1, putative
  • PCHAS_135200 apurinic/apyrimidinic endonuclease, putative
  • PKH_122030 apurinic/apyrimidinic endonuclease Apn1, putative
  • NCLIV_041140 endonuclease V, putative
  • cgd1_310 AP endonuclease of the TIM barrel fold, possible bacterial horizontal transfer
  • Chro.10041 apurinic/apyrimidinic endonuclease Apn1
  • CMU_034980 apurinic endonuclease family protein
  • TP02_0334 apurinic/apyrimidinic endonuclease, putative
  • TA12590 apurinic/apyrimidinic endonuclease Apn1-like, putative
  • BBOV_III005900 apurinic endonuclease (APN1) family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_088680 endonuclease V, putative
MHLSSLILVLALASLCRPVISKRSQCGVLPQTTNKTPCVVSARLPRHKCVDLRANTTTSTPRKNSGAPGWKCSWSLTQQT
QLHEHTPRPASSTVSFLDCVLRSCFSSVSNHSSVFWRGSQSEKRTAFLLLTPRSVHVHLFLSASQHRFAYKPQSAVVLLP
IKHDCLVIASCCPASRATERESTLSGTSVSANGTAMTAAASLRKTKGADAAASQGRAGPQPRGVKRDQADSPGELPATEE
TTSPISSVSRGVSGSGKPVVSKRIKTEPDTQTTSAALDTKADGTADAKHSSVKKSAMKSEAHEGNHNGTEGEMKQKVNAK
GAKVKGETGDEADDTQEGEAKNGGKAPKRSAGKKQSTAGNLPTEVDEVFLRHRAVAEKSRKFLGAHISAAGGVQNAPVNC
LAIGGQAFAFFLKNQRRWDSPPISDESADGFKAEVAKLKLDGPEHILPHGSYLINLANPDAAKRKVSYNAFLDDLQRCEQ
IGVHRYVFHPGSTVGQCTKEESIRHIAECLNKAIAATKSVTILLENMAGQKNVLCSEFEDLRDIIALVDRKDRIGVCLDT
CHLYSAGHDIKTEEKFEAVMKKFDSIVGMKYLKAMHINDSKAPLGSGLDRHEHLGKGTLGMAPFKFIMQHPTWFKDMPLV
LETPDVDNSGPAMWRKETEMMYKFIEE

Gene-Specific Links for TGME49_088680

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins