ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_088650 (GRA12)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
dense granule during extracellular tachyzoite
parasitophorous vacuole during shortly after invasion of tachyzoite

Who localised this protein by microscopy?

Michelin, A., Bittame, A., Bordat, Y., Travier, L., Mercier, C., Dubremetz, J. F., Lebrun, M.
GRA12, a Toxoplasma dense granule protein associated with the intravacuolar membranous nanotubular network. (2009 Feb, Int J Parasitol) PubMed / full text
   more detail about this publication

dense granule during extracellular tachyzoite, parasitophorous vacuole during shortly after invasion of tachyzoite
  • "It is secreted into the PV from the anterior pole of the parasite soon after the beginning of invasion, transits to the posterior invaginated pocket of the parasite where a membranous tubulovesicular network is first assembled, and finally resides throughout the vacuolar space, associated with the mature membranous nanotubular network."
  • Microscopy type: Light and EM
  • Microscopy method: Ty tag
  • Strain: RH hxgprt-
  • Gene model mapping comments: Blast from ACH87600, annotation doesn't match
  • Localisation record: dense granule during extracellular tachyzoite, PV during shortly after tachyzoite invasion
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115392

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_088650 hypothetical protein
MRAIVASTQQFLRPVGSRPLAGISIVVVVALAIALGTAADVGRHVGGFSGPFPMTLRSGQWRLDHGACFVGKAKNLVVDP
LPRVSPQGPQPLDVTTTGSALCWWLDSMYAAHMSLKAAWERRHQEAKNRTSWLNLWRRFANWWASFPEFQIDVSVLYLDL
WNDDFYGHPLPWFSAEFSYTPPSGRYAYNLFDKLQSHFASAPGTAVQEVFLLLAPAPTFNQPVEKRSSIVARAATVAAGN
ELFKEALGHQRVDEVLSMVPADPFRLMLSTSAFSFQAKIGDFWERGLDCMLGSRLNLRWDQVGTSVCRYMTAKASETGSG
LAASFLNTVEVRVTGMDFFNHAAPVFKTEFIEGIITKRATYIPVSMYLSTDPTLTHEYEAAKTVKRAVQAGRVGAALARG
LVNFARATNQKADESHEGQTKTPTSGVRGSAGSKHN

Gene-Specific Links for TGME49_088650

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins