ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_088500 (FAD Malate-dehydrogenase (MDH-FAD))

malate:quinone oxidoreductase, putative, a gene from Toxoplasma gondii

Compiled localisation
mitochondrion during tachyzoite

Who localised this protein by microscopy?

Fleige, T., Pfaff, N., Gross, U., Bohne, W.
Localisation of gluconeogenesis and tricarboxylic acid (TCA)-cycle enzymes and first functional analysis of the TCA cycle in Toxoplasma gondii. (2008 Aug, Int J Parasitol) PubMed / full text
   more detail about this publication

mitochondrion during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_21560

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_088500 malate:quinone oxidoreductase, putative
MAAALRFLNTALTTSRPLFASGSRPQLSPLFFIENARLRGTFSRRFSSAAAPTATAADTKPASATPLQKPGSSTGGMTSG
PASPSRQSTPSISTGRHATDVYDVFIVGGGVTGTALLYELCTFTDLKKIGLVERRPSFAVVASCPRNNSQTIHCGDIETN
YTVEKAKIVKRQADMLRNFATKLPPSERDLVVQKMQKMALAVGDTECEFMEKRYHVFKNLFTRMQFIDKKTIAEVEPRVG
MKNSHSMRSDSACAIFIPDEHSAVNYYHLAASFVDQAKRHANGKQVDIQTSTELLDLKHDGDTFSIKTSRGIERARFVVV
SACGQSLLLAQRMGYGLNFSCLPMAGSFYFAPEMLNGKVYTCQDPRLPFAAVHGDPDLVAVGKTRFGPTALPLPMLERYN
MSSIGDFLRVINPDINLVKVYLDLLGTSHMRNYVLRNFLFEVPKLNTVLFANDVKKIVPSIKPEDLTYAQGYGGVRPQLI
DKVQKKLLLGEGKINPGTGIIFNITPSPGGTTCLGNAELDMRAICKRLGANIDEKLFKRTLLEGEYPVAH

Gene-Specific Links for TGME49_088500

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins