ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_088380 (Hsp90)

heat shock protein 90, a gene from Toxoplasma gondii

Compiled localisation
cytosol during extracellular tachyzoite and mature bradyzoite and tachyzoite
nucleus during bradyzoite and mature bradyzoite

Who localised this protein by microscopy?

Echeverria, P. C., Figueras, M. J., Vogler, M., Kriehuber, T., de Miguel, N., Deng, B., Dalmasso, M. C., Matthews, D. E., Matrajt, M., Haslbeck, M., Buchner, J., Angel, S. O.
The Hsp90 co-chaperone p23 of Toxoplasma gondii: Identification, functional analysis and dynamic interactome determination. (2010 Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

nucleus during bradyzoite
  • "Recently we have reported that cytoplasmic Hsp90 translocates to the nucleus when T. gondii differentiates to bradyzoite [2]."
  • Microscopy type: fixed light
  • Microscopy method: antibody
  • Strain: PK
  • Gene model mapping comments: blast from AY344115, annotation matches
  • Localisation record: nucleus during bradyzoite
  • Comment: Tachyzoite localisation not annunciated
  • Other genes localised in this publication: 58 kDa phosphoprotein, putative, P23 co-chaperone, putative

Frankel, M. B., Knoll, L. J.
Functional analysis of key nuclear trafficking components reveals an atypical Ran network required for parasite pathogenesis. (2008 Oct, Mol Microbiol) PubMed / full text
   more detail about this publication

cytosol during extracellular tachyzoite
  • "We co-stained with either 4',6'-diamidino-2-phenylindole or T. gondii histone H2B (Dalmasso et al., 2006) to indicate the nucleus, and heat-shock protein 90 (Hsp90) as a cytosolic marker (Echeverria et al., 2005)."
  • Microscopy type: fixed light
  • Microscopy method: antibody
  • Strain: Pru HXGPRT-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytosol during extracellular tachyzoite
  • Other genes localised in this publication: GTP-binding nuclear protein RAN/TC4, putative, histone H2B variant 1

Echeverria, P. C., Matrajt, M., Harb, O. S., Zappia, M. P., Costas, M. A., Roos, D. S., Dubremetz, J. F., Angel, S. O.
Toxoplasma gondii Hsp90 is a potential drug target whose expression and subcellular localization are developmentally regulated. (2005 Jul 22, J Mol Biol) PubMed / full text
   more detail about this publication

cytosol during mature bradyzoite and tachyzoite, nucleus during mature bradyzoite
  • "fluorescence microscopy studies revealed that Hsp90 is present in the cytosol of tachyzoites and both in the nucleus and cytosol of mature bradyzoites"
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: RH ΔUPRT and PK
  • Gene model mapping comments: blast from AY344115
  • Localisation record: cytosol during tachyzoite, cytosol and nucleus during mature bradyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10088

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_088380 heat shock protein 90
MADTETFAFNADIQQLMSLIINTFYSNKEIFLRELISNASDALDKIRYEAITDPEKLKGAERLFIRIVPNKQNNTLTIED
DGIGMTKAELVNNLGTIARSGTKAFMEALQAGGDISMIGQFGVGFYSAYLVADKVTVVSRHNDDEMYVWESSAGGSFTVS
KAEGQFENIVRGTRIILHMKEDQTEYLEDRRLKDLVKKHSEFISFPIELAVEKSVDKEITESEDEEKPAEDAEEKKEEGE
EEKKEEGAEKKKKTKKVKEVVVEYEQLNKQKPLWMRKPEDVTWEEYCAFYKSLTNDWEDPLAVKHFSVEGQLEFKALLFL
PKRAPFDLFETRKKRNNVRLYVRRVFIMDDCEDLIPEWLNFVRGVVDSEDLPLNISRESLQQNKILKVIKKNLVKKCLEM
FQELEEKKEDYTKFYEQFSKNLKLGIHEDTSNRNKIAELLRFHTSKSGDDVVSLKEYVDRMKESQKDIYYITGESRQSVA
SSPFLEALRKKGYEVIYMTDPIDEYAVQQLKEFDGKKLRCCTKKGLELEDDEEEKKKFEELKAEFEPLCKLMKEVLHDKV
EQVVVSNRITDSPCVLVTSEYGWSANMERIMKAQALRDNSMTTYMVSKKTMEINPTNPIMEELKKKSNADKSDKTVKDLI
WLLFDTALLTSGFSLDEPTQFAARIHRMIKLGLSIDEDDEELRAEEDLPPLEEVEGAVEETSKMEEVD

Gene-Specific Links for TGME49_088380

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins