ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_087210 ()

proteasome subunit alpha type 2, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11165

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFF0420c proteasome subunit alpha type 2, putative
  • PBANKA_010710 proteasome subunit alpha type 2, putative
  • PY03034 proteasome subunit alpha type 2
  • PVX_113585 20S proteasome subunit alpha type 2, putative
  • PCHAS_010770 proteasome subunit alpha type 2, putative
  • PKH_114070 proteasome subunit alpha type 2, putative
  • TGME49_087210 proteasome subunit alpha type 2, putative
  • NCLIV_013780 hypothetical protein
  • cgd7_3660 proteasome subunit alpha2, protease of the acylase family and NTN hydrolase fold
  • Chro.70408 proteasome subunit alpha type 2 (20S proteasome alpha subunit B) (20S proteasome subunit alpha-2)
  • CMU_013680 proteasome subunit alpha type 2, putative
  • TA18320 proteasome subunit alpha type 2, putative
  • BBOV_III000310 proteasome A-type and B-type family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_087210 proteasome subunit alpha type 2, putative
MAGDGEYSFSLTTFSPSGKLVQIEYALNRVQQGAPALGIKAKNGVVIAAEKKLTTPLIEESSVRKVEHFTPNIGCVCAGM
PADYRVVMKKGRKEAAAYNLFYNSPISVSQLVQDVAAVMQEYTQSGGVRPFGLSLLVAGYDEYGPQLYQVDPSGAYFGWK
ASAIGRDMQNAKTFLEKRYNPDIELEDAIHTAILTLKEGFEGAMNEHNIEIGVVGEDRKFRILTPAEIKDYLGEVE

Gene-Specific Links for TGME49_087210

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins