ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_086790 (NF2)

pinin/SDK/memA/ domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation
nucleus during intracellular tachyzoite

Who localised this protein by microscopy?

Olguin-Lamas, A., Madec, E., Hovasse, A., Werkmeister, E., Callebaut, I., Slomianny, C., Delhaye, S., Mouveaux, T., Schaeffer-Reiss, C., Van Dorsselaer, A., Tomavo, S.
A novel Toxoplasma gondii nuclear factor TgNF3 is a dynamic chromatin-associated component, modulator of nucleolar architecture and parasite virulence. (2011 Mar, PLoS Pathog) PubMed / full text
   more detail about this publication

nucleus during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_27029

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • MAL13P1.75 conserved Plasmodium protein, unknown function
  • PBANKA_141320 conserved Plasmodium protein, unknown function
  • PY00474 mature parasite-infected erythrocyte surface antigen
  • PVX_122555 hypothetical protein, conserved
  • PCHAS_141500 conserved Plasmodium protein, unknown function
  • PKH_141380 conserved Plasmodium protein, unknown function
  • NCLIV_013870 pinin/SDK/memA/ domain-containing protein, putative
  • TP01_1193 hypothetical protein, conserved
  • TA09650 hypothetical protein, conserved
  • BBOV_III008080 hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_086790 pinin/SDK/memA/ domain-containing protein
MSESRLRQEIRKLVTEQRQLNRRLQQQRRPPGELFSLDKPEASAPSLPQKRELDASSELPQLPVQTPLGNSAEVAADRVT
YSFEGEEFQVEKRPKLEAPDEKTATRNRRMFGALAGHLQRAKRQLLMEQSTDLAHKQKQQEERVAQKLAMSQKNIAKIAR
LEWEERRQQEQLRLEEVSTELSNKENELMRLHLAKHYKNMEVFIGTEAQPTLFWAPAKWDDATRRLQEQTKLWIRTKIEH
IEETDYTYRPQGSAAGREDRESSEVKAEGETVAAGEDERAMCTELDTSEPRATKKGLSADSDDASDKVSETKS

Gene-Specific Links for TGME49_086790

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins