ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_086730 ()

signal recognition particle 19 kDa protein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11399

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFL0785c signal recognition particle SRP19
  • PBANKA_143200 signal recognition particle 19 kD protein, putative
  • PY05584 SRP19 protein, putative
  • PVX_123495 signal recognition particle 19 kd protein, putative
  • PCHAS_143400 signal recognition particle 19 kD protein, putative
  • PKH_143350 signal recognition particle 19 kD protein, putative
  • TGME49_086730 signal recognition particle 19 kDa protein, putative
  • NCLIV_013930 signal recognition particle 19 kDa protein, putative
  • cgd6_1870 signal recognition particle SPR19
  • Chro.60222 SRP19-domain protein
  • CMU_008020 signal recognition particle 19 protein, putative
  • TP01_0163 signal recognition particle, putative
  • TA19205 signal recognition particle, putative
  • BBOV_IV001360 signal recognition particle SRP19 subunit
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_086730 signal recognition particle 19 kDa protein, putative
MGRQRDQRRQGGGMPGGFPGGFPAGFPGGLPGGFPGGLPGGFPGGLDAAALGGMPAGLPEGLSPELLAQMLGGMPGGPSV
GMDQHSDEAGMMQNDGVDRSRWQIVYPAYINKKRTAAMGRRVQLSIAVEDPKVDEMKKICDHFNIPAAIEYVKRYPRDWL
LSHGRLRFQLKDENDQLHNQEIPNKKILMRRMCELIPQLKSRSTPTGPVASAASSTKKKKRK

Gene-Specific Links for TGME49_086730

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins