ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_086720 (Hsp28)

heat shock protein 28, a gene from Toxoplasma gondii

Compiled localisation
mitochondrion during tachyzoite
during not bradyzoite

Who localised this protein by microscopy?

de Miguel, N., Echeverria, P. C., Angel, S. O.
Differential subcellular localization of members of the Toxoplasma gondii small heat shock protein family. (2005 Dec, Eukaryot Cell) PubMed / full text
   more detail about this publication

mitochondrion during tachyzoite, during not bradyzoite
  • "The localization of Hsp28 displayed a staining pattern inside the mitochondrion of the parasite that was similar to that observed with the MitoTraker marker"
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: PK
  • Gene model mapping comments: blast from AY650281, annotation matches
  • Localisation record: mitochondrion during tachyzoite
  • Other genes localised in this publication: small heat shock protein 20, Hsp20/alpha crystallin domain-containing protein, small heat shock protein 21
  • "Colocalization of Hsp28 and mitotracker staining is observed in the merged image in the tachyzoite stage. Note the lack of reactivity of rabbit polyclonal anti-Hsp28 in the bradyzoite stage."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: ME49
  • Gene model mapping comments: inferred from another publication
  • Localisation record: not during bradyzoite
  • Other genes localised in this publication: small heat shock protein 20, Hsp20/alpha crystallin domain-containing protein, small heat shock protein 21

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10315

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_086720 heat shock protein 28
MSSSSGSAADSGNTLEDQRQGQDGMSRRDHGEEDFVRGNPLLMSTMMPQLSTMDRMYAEMMDDMSRIHHEMNRFYHQHFN
SAAPFMRGAHQQPYETRPWWRPSFWFQQRNAAQTPMAIEGGSSRNPEVHELTGGQMVPMPGRQGPSPASPWDVMPFAWGG
RGSLSAGSMPKVDMKDTGSEFVVHADVPGMDRENLRVDVHDGVLRISGTQRDEKQQQEEGFYLQERSQSSFSRSFVLPDK
VKEDQIKASLTNGVLQVHVPKETPTQPPAIRNITIE

Gene-Specific Links for TGME49_086720

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins