ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_086450 (GRA5)

dense granule protein 5 precursor, a gene from Toxoplasma gondii

Compiled localisation
dense granule during bradyzoite and sporozoite and tachyzoite
parasitophorous vacuole during bradyzoite and tachyzoite invasion and tachyzoite
parasitophorous vacuole membrane during bradyzoite and sporozoite invasion and tachyzoite
during not merozoite
oocyst wall during bradyzoite and tachyzoite
not parasitophorous vacuole during bradyzoite and sporozoite

Who localised this protein by microscopy?

Besteiro, S., Michelin, A., Poncet, J., Dubremetz, J. F., Lebrun, M.
Export of a Toxoplasma gondii rhoptry neck protein complex at the host cell membrane to form the moving junction during invasion. (2009 Feb, PLoS Pathog) PubMed / full text
   more detail about this publication

parasitophorous vacuole membrane during tachyzoite

Igarashi, M., Kano, F., Tamekuni, K., Kawasaki, P. M., Navarro, I. T., Vidotto, O., Vidotto, M. C., Machado, R. Z., Garcia, J. L.
Toxoplasma gondii: cloning, sequencing, expression, and antigenic characterization of ROP2, GRA5 and GRA7. (2008, Genet Mol Res) PubMed / full text
   more detail about this publication

dense granule during tachyzoite
  • "The present study cloned genes from two secretory organelles from T. gondii, dense granules and rhoptry. Analysis of sequence variation in the T. gondii rop2-, gra5- and gra7- coding regions from Londrina-RH strain showed some heterogeneity in nucleotides and predicted amino acid sequences (data not shown), when compared to the RH strains from the GenBank. However, this heterogeneity neither changed reactivity in the indirect fluorescence antibody test nor immunoblotting to T. gondii tachyzoites."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from L06091, annotation matches
  • Localisation record: dense granule during tachyzoite
  • Other genes localised in this publication: Rhoptry kinase family protein ROP2A (incomplete catalytic triad), dense granule protein 7

Ferguson, D. J.
Use of molecular and ultrastructural markers to evaluate stage conversion of Toxoplasma gondii in both the intermediate and definitive host. (2004 Mar 9, Int J Parasitol) PubMed / full text
   more detail about this publication

parasitophorous vacuole during bradyzoite and tachyzoite, oocyst wall and parasitophorous vacuole membrane during bradyzoite, during not merozoite

Ferguson, D. J., Cesbron-Delauw, M. F., Dubremetz, J. F., Sibley, L. D., Joiner, K. A., Wright, S.
The expression and distribution of dense granule proteins in the enteric (Coccidian) forms of Toxoplasma gondii in the small intestine of the cat. (1999 Mar, Exp Parasitol) PubMed / full text
   more detail about this publication

during not merozoite, dense granule during bradyzoite and sporozoite and tachyzoite, oocyst wall and parasitophorous vacuole during tachyzoite, not parasitophorous vacuole during bradyzoite and sporozoite

Tilley, M., Fichera, M. E., Jerome, M. E., Roos, D. S., White, M. W.
Toxoplasma gondii sporozoites form a transient parasitophorous vacuole that is impermeable and contains only a subset of dense-granule proteins. (1997 Nov, Infect Immun) PubMed / full text
   more detail about this publication

parasitophorous vacuole membrane during sporozoite invasion, dense granule during sporozoite

Lecordier, L., Mercier, C., Torpier, G., Tourvieille, B., Darcy, F., Liu, J. L., Maes, P., Tartar, A., Capron, A., Cesbron-Delauw, M. F.
Molecular structure of a Toxoplasma gondii dense granule antigen (GRA 5) associated with the parasitophorous vacuole membrane. (1993 May, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

dense granule, parasitophorous vacuole during tachyzoite invasion
  • "The P21 antigen of Toxoplasma gondii, defined by the monoclonal antibody TG17-113, has been described as a dense granule component, secreted in the parasitophorous vacuole during host cell invasion. The present work reports the cloning of the gene encoding the P21 antigen, for which we propose the name GRA 5."
  • Microscopy type:
  • Microscopy method: monoclonal antibody to protein
  • Strain:
  • Gene model mapping comments: blast from TOXGRA5A, annotation matches
  • Localisation record: dense granule, PV during tachyzoite invasion
  • Comment: 8515776 – could only view abstract online
  • Other genes localised in this publication: -

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>TGME49_086450 dense granule protein 5 precursor
MASVKRVVVAVMIVNVLALIFVGVAGSTRDTGSGGDDSEGAWGGEQQQVQQHGQSEDRSLFERGRAAVTGHPVRTAVGLA
AAVVAVVSLLRLLRRRRRRAIQEESKESATAEEEEVAEEE

Gene-Specific Links for TGME49_086450

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins