ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_086080 ()

U5 small nuclear ribonucleoprotein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12502

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF10_0041 U5 small nuclear ribonuclear protein, putative
  • PBANKA_120220 U5 small nuclear ribonuclear protein, putative
  • PY05417 Drosophila melanogaster LD28793p-related
  • PVX_094390 U5 small nuclear ribonuclear protein, putative
  • PCHAS_120290 U5 small nuclear ribonuclear protein, putative
  • PKH_080250 U5 small nuclear ribonuclear protein, putative
  • TGME49_086080 U5 small nuclear ribonucleoprotein, putative
  • NCLIV_014360 hypothetical protein
  • cgd3_3880 Snu114p GTpase, U5 snRNP-specific protein, 116 kDa
  • CMU_032030 U5 small nuclear ribonucleoprotein subunit, putative
  • TA09375 U5 snRNP subunit, putative
  • BBOV_II004050 u5 small nuclear ribonuclear protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_086080 U5 small nuclear ribonucleoprotein, putative
MDGANLYDEFGNYIGPELGEDEESEGEEEEVDRPLPVVEEETDRSVAVRGLVSIGEEESTAAAVVPHELKKYYPDHAEVY
PEADTVVQEEDTQPITQPIIAPVSTADFDLLEKQLPVTSFSFDYLASLMFQPESIRSVCLLGHLHSGKTTFLDMLVEETH
HPPHNSRRSAPARMAKRYTDSRKDEQQRALSIKASPMSLVLQSSRYKNFLFNIFDTPGHVNFNDECCAAMRLCDGAIIVI
DALEGVMSNTDRLLRHAVEEQLDIVVVINKLDRLILELRLPPADAYHKIRHTLEEVNSILEQVCEVRGRKPIVISPLNNN
VLFAMGQFGLIFSTRSFAKLHIDNYHPDRKAHGPRLPGEPASVEAERTPFPSVEVFEQALWGDLWIHPETRKVVDKPPFS
DAPRTFVEFIMEPLYKLVAHVVAEEQPTLQPTLEELGIYLKKDDYKLDSRTLLKKVLSQFFGDASALVDTVIEAVPDPKT
NAPKKTKQLYTGNQEGRVAEDMKTLDSESDVLMIYSTKNYHRPNNFHSFDVLGRVMSGTVYKGQRVKVLGEAFSLDDDED
MVIRDITHLWVLEGRYRVEVSHVPAGNWVLIGGVDLSVLKTSTITNVDHSEEVEIFSPLLFNSVPVIKVACEPLQPSELP
KMLEALRRIDKSYPISRTRVEESGEHVILGTGEMYLDCVLHDLRKLYGDLELKVADPVVQFCETVVESSALKCFAETPNK
KNKIYMLAEPLDKQIGEDIEKGLVSDRWETRVLGEHFTSKYGWDVLAARSIWAFGPDARGPNVLVDDTLPSEVDKNLLGT
VRESIVQGFQWATREGPLIEENIRNVKFKILDAAIAADPLQRGGGQVIPTARRVAYSALLLATPRLMEPVYFTEIQCPAD
CVSAIYTVLARRRGNVSRDMPKPGTPLYIVHAYLPAIESFGFETDLRTHTCGQAFCLSMFDHWAIVPGDPLDKAILLRPL
EPAPAPHLAREFLLKTRRRKGLSEDVSIAKFFDDPMLVNIATDLQQFL

Gene-Specific Links for TGME49_086080

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins