ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_085980 (glucosephosphate-mutase I, PRP1)

phosphoglucomutase/parafusin related protein 1, putative, a gene from Toxoplasma gondii

Compiled localisation
conoid and cytosol during tachyzoite

Who localised this protein by microscopy?

Fleige, T., Pfaff, N., Gross, U., Bohne, W.
Localisation of gluconeogenesis and tricarboxylic acid (TCA)-cycle enzymes and first functional analysis of the TCA cycle in Toxoplasma gondii. (2008 Aug, Int J Parasitol) PubMed / full text
   more detail about this publication

cytosol during tachyzoite

Matthiesen, S. H., Shenoy, S. M., Kim, K., Singer, R. H., Satir, B. H.
Role of the parafusin orthologue, PRP1, in microneme exocytosis and cell invasion in Toxoplasma gondii. (2003 Sep, Cell Microbiol) PubMed / full text
   more detail about this publication

conoid during tachyzoite
  • "In post-embedding gold particle labelling of LR white sections shows that PRP1 is localized to the micronemes. "
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Genbank AF295534 found from referenced article 11831391 – blasted from there
  • Localisation record: conoid during tachyzoite
  • Other genes localised in this publication: microneme protein MIC3

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10663

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • NCLIV_014450 Phosphoglucomutase 2, related
  • cgd2_3260 phosphoglucomutase, tandemly duplicated gene
  • cgd2_3270 phosphoglucomutase, tandemly duplicated gene
  • Chro.20343 hypothetical protein
  • CMU_003300 phophoglucomutase-1 protein, putative
  • CMU_003310 phosphoglucomutase/phosphomannomutase, C-terminal domain-containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_085980 phosphoglucomutase/parafusin related protein 1, putative
MGAKASRMRTKEEACRGSANPSHKGLPADQILSRPTTAYQDQKPGTSGLRKKTKVFMQKDYLANFAQSVFNCLPEEEKKG
GTLLVSGDGRFFSHEAIYEICSIAAGNGVGRVWIGLNGLASTPACSAIIRERENGICFGGFLLTASHNPGGIDEDFGVKY
DTANGAPGYEALMNEVWEKSKTISTIKYAKLPKFSIDKLGVQVNIDGAFQVEVIDPIEDWLKLMKEAFHFPAIKRLLALP
HFSFVYDSMHGVSGPYAEKLFIEEFGAKRECLMRQDPLPDFGGHHPDPNLTYAEELVAKMKVLHPDQVDASTPLFGAAGD
GDCDRNMILGRGFFVTPSDSVALIALYAEKCIPYFFVDKATGKGGLTGLARSMPTSRALDNVAKKLNKDVYETPTGWKYF
TNLMDASRISICGEESFGTGSVHVREKDGLWAVLAWLSILAYRNGCMGDVEKERELLQEGKSVDVSPPATKETDFVSVQQ
IVEEFWKEYGRNFYCRYDFENKDSASAHEMLQALEELSKSSPAEITGKVASHVDENLLKEMEIESMDWFKYTDPVDKQVS
DHQGVRLFLKGGSRIIWRLSGTGSTGATIRVYMERYEPDASKVLQDERTALKDIAAFALQFCDMKKYIGTETPTVIT

Gene-Specific Links for TGME49_085980

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins