ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_085700 (Ufd1Ap)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
apicoplast during 24 hours after tachyzoite infection

Who localised this protein by microscopy?

Agrawal, S., van Dooren, G. G., Beatty, W. L., Striepen, B.
Genetic evidence that an endosymbiont-derived endoplasmic reticulum-associated protein degradation (ERAD) system functions in import of apicoplast proteins. (2009 Nov 27, J Biol Chem) PubMed / full text
   more detail about this publication

apicoplast during 24 hours after tachyzoite infection

Orthology

OrthoMCL

Part of OrthoMCL group OG4_25441

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PFI0810c apicoplast Ufd1 precursor
  • PBANKA_081750 conserved Plasmodium protein, unknown function
  • PY04576 hypothetical protein
  • PVX_099250 hypothetical protein, conserved
  • PCHAS_081780 conserved Plasmodium protein, unknown function
  • PKH_071380 conserved Plasmodium protein, unknown function
  • NCLIV_014670 YGR048Wp-like protein, related
  • TP01_1135 hypothetical protein
  • TA16520 ubiquitin-fusion degradation pathway component, UFD1 homologue, putative
  • BBOV_IV011730 ubiquitin fusion degradation protein UFD1, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_085700 hypothetical protein
MASGQKVQVMTKTEKTTVQMHRKQQIDAQSMQETKEKQKKKEKKKYEQMKEEKKYKQKKEEKKKAVMEKEKKKEKKEETE
YISEKGDVGCPRGYRMSFGARESPRLEQRVEDLNILFRQQGSTDRVYLVLPLSEALNPPADHFSHNHIMEGDKAILPREV
LPLLLERQWDAPWHFLLEKVFDLCDSEALATTPPRFAAGRLPQALPGGDKAANAECEGEKKARQRTSPRRVSVSVLDFSA
PRNFIFLPLWVMKALDLRPFSIVACKWERLPLAGHVTLQPTSSAFVRAVQATGRDIQKVLEQEIRHYSSLTANSVIPVKI
QGQTFRLHVRQIQAEGNAATGEDADHVCVQDSDVATTLLPAKDEERTETEPSAVAQGRLTGEQEKQREKKRTEDTKHA

Gene-Specific Links for TGME49_085700

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins