ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_084540 ()

ATP synthase subunit O, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10878

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • MAL13P1.47 mitochondrial ATP synthase delta subunit, putative
  • PBANKA_140850 mitochondrial ATP synthase delta subunit, putative
  • PY03110 ATP synthase F1, delta subunit, putative
  • PVX_122330 ATP synthase delta chain, mitochondrial, putative
  • PCHAS_141040 mitochondrial ATP synthase delta subunit, putative
  • PKH_140890 mitochondrial ATP synthase delta subunit, putative
  • TGME49_084540 ATP synthase subunit O, putative
  • NCLIV_015180 ATP synthase, related
  • CMU_025000 ATP synthase F1, delta subunit, putative
  • TP01_0929 ATP synthase delta chain, mitochondrial precursor, putative
  • TA06450 ATP synthase delta chain, putative
  • BBOV_IV008470 ATP synthase F1 delta subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_084540 ATP synthase subunit O, putative
MALPLLASRRLFSSFVFRGQPSTLSSNLSLVRIRGLHGGSLSPPSATLPRAVQLFSSRIAFSTAAAEDSGASQTLEGRYA
SALFRVAKKKNQLEKVYGDLESVRNALKDSSEFRLFVDSPAVSVQQKLDVLRQLVNRYKFDPLTGNLLTTLVENKRLPML
ARVADAFDAMYRKEKGEVKCLVTSAKPLSAQQQKEIVAALQNRAGTQARLIIDYAVSPQIMGGLVVRLGEQVLDFSVATR
LDRLQSQLLAPL

Gene-Specific Links for TGME49_084540

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins