ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_083850 ()

peptidyl-prolyl isomerase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10133

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_146040 peptidyl-propyl isomerase, putative
  • PY02360 FK506-binding protein
  • PVX_101260 70 kDa peptidylprolyl isomerase, putative
  • PCHAS_146270 peptidyl-propyl isomerase, putative
  • PKH_146480 peptidylprolyl isomerase, putative
  • TGME49_083850 peptidyl-prolyl isomerase, putative
  • TGME49_118270 hypothetical protein
  • NCLIV_011240 FKBP-type peptidyl-prolyl cis-trans isomerase FklB, related
  • NCLIV_028870 Peptidylprolyl isomerase D (Cyclophilin D), related
  • cgd6_2690 macrophage infectivity potentiator (MIP);FKBP peptidyl-prolyl cis-trans isomerase-like fold, signal peptide + ER retention motif
  • Chro.60310 peptidyl-prolyl isomerase/macrophage infectivity potentiator
  • CMU_007140 peptidyl-prolyl cis-trans isomerase, fkbp-type family protein
  • TP02_0901 peptidyl-prolyl cis-trans isomerase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_083850 peptidyl-prolyl isomerase, putative
MGGTCEEASSHAHSHSCCGSGSDKVDVDPASIVDAGEEISSGDKGVFKKILKEGDGPQPQPGEEVVVHYTGTLLDGTKFD
SSRDRDSPFKFIIGEGQVIRGWDLGVMKMKRGERAMLTIQPDYGYGASGSPPVIPPNSVLKFDVELLDSHPKPKDKWEMN
VGEKLEGANAEKERGNEAFKKGGYAEAAAAYREGLDFFSFTENWTDEEREQQKRLELPLRLNLATCCNRLGEFSEAIEQT
TKALEMDPESSKGWYRRGVARMAVGQLDEARHDFVQAAKLDPKNVEIRRELEKCKKKIEEVRAKEKSAFGNIFKKVDLYT
GKSALLSSSSSSVVSVRAEKQGVRNVSKCPKVYMDIKVGDNAPKRVVFALYNDTVPKTAENFRALCTGEKGEGKKGKPLC
FKNSLFHRVIPGFMMQGGDFTNGDGTGGESIYGPQFNDEKFVDQHTGRGQLSMANCGPNTNSSQFFITFGPAPHLDGKHV
VFGEVVEGQDVLDEVEDVETDKSNDRPKQDVQIVDCGEVKC

Gene-Specific Links for TGME49_083850

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins