ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_083780 (GPI)

glucose-6-phosphate isomerase, a gene from Toxoplasma gondii

Compiled localisation
cytosol during intracellular tachyzoite

Who localised this protein by microscopy?

Fleige, T., Fischer, K., Ferguson, D. J., Gross, U., Bohne, W.
Carbohydrate metabolism in the Toxoplasma gondii apicoplast: localization of three glycolytic isoenzymes, the single pyruvate dehydrogenase complex, and a plastid phosphate translocator. (2007 Jun, Eukaryot Cell) PubMed / full text
   more detail about this publication

cytosol during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10418

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF14_0341 glucose-6-phosphate isomerase
  • PBANKA_100880 glucose-6-phosphate isomerase, putative
  • PY00618 Phosphoglucose isomerase
  • PVX_084735 glucose-6-phosphate isomerase, putative
  • PCHAS_100970 glucose-6-phosphate isomerase, putative
  • PKH_131330 glucose-6-phosphate isomerase
  • NCLIV_028830 Glucose-6-phosphate isomerase (EC 5.3.1.9), related
  • cgd2_3200 glucose-6-phosphate isomerase, cytosolic (GPI) (phosphoglucose isomerase) (PGI) (phosphohexose isomerase) (PHI)
  • Chro.20336 glucose-6-phosphate isomerase
  • CMU_003240 glucose-6-phosphate isomerase family protein
  • TA04045 glucose-6-phosphate isomerase, putative
  • BBOV_II000240 glucose-6-phosphate isomerase protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_083780 glucose-6-phosphate isomerase
MAPTQLEQCASHGKLLQEKKKLEKLHLRDLLKDEARNDLLIRSTDQGVYLDFSRQKITLETLQHLVNLAHERQVPAMVKR
MFSGEKINQTENRAVLHVALRMPEGSEPVHVDGKNVLDEVHAVLRRIRVFSEKVRSGEIRGHTGKKLVNVISIGIGGSYL
GTEFVHLALAAEGYAAEKAHGRQIHFLANVDPVDVWLAERGFDPEETLVVVISKTFTTAETMMNARSVRDWYLHHYKGDE
RALGAHFCAVSTNLDGTSKFGIQSDRVFGFWDWVGGRYSVTSAVGILPLALQYGYDVAQEFLNGAHAMDVHFKTAELADN
LPMLMGLISVWNATFFGYSNVAVLPYAQALLRFPAHIQQLTMESNGKRVTMDGKTLDFDVGEIFFGEPGTNGQHSFYQLI
HQGRVIPAEFIGFCKSQRAIKLKEEPVSNHDELMSNFFAQPDALAFGKTPEELRKEGIPEKLVPHKTFPGDRPSCMLLFP
EISPFHIGQLLALYEHRVAVEGWLWGINSFDQWGVELGKVLAKGVRGILQKRREGKAPHESGQSELCSSTRKILEHYVQQ
SKA

Gene-Specific Links for TGME49_083780

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins