ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_082050 (PP2Chn) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
host cell nucleus and not evacuole during after tachyzoite invasion
rhoptry body during tachyzoite invasion

Who localised this protein by microscopy?

Gilbert, L. A., Ravindran, S., Turetzky, J. M., Boothroyd, J. C., Bradley, P. J.
Toxoplasma gondii targets a protein phosphatase 2C to the nuclei of infected host cells. (2007 Jan, Eukaryot Cell) PubMed / full text
   more detail about this publication

host cell nucleus and not evacuole during after tachyzoite invasion, rhoptry body during tachyzoite invasion
  • "We demonstrate that Toxoplasma gondii also uses secretion from the rhoptries during invasion to deliver a parasite-derived protein phosphatase 2C (PP2C-hn) into the host cell and direct it to the host nucleus. οΎ… 9D6 staining is not seen in evacuoles formed by cytochalasin D-treated parasites."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: RHhpt-
  • Gene model mapping comments: blast from EF450457, comments match, gene model inconsistent
  • Localisation record: host cell nucleus during after tachyzoite invasion, rhoptry body during tachyzoite invasion, not evacuole during after tachyzoite invasion
  • Comment: 17085638 says the 2 gene models 74.m00766/74.m00767 should be joined together
  • Other genes localised in this publication: Rhoptry kinase family protein ROP2A (incomplete catalytic triad), hypothetical protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_114809

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_082050 hypothetical protein
MTRAFGSFDFKKGGQGKLQQDLVSAVPDVTTFFAYPGDDIVAGTAGAFAHFRSHAAIAAAIALYPVSPETVLDAAKAMVV
NAKRRKVTKNISTFVRHLPESRTRSQKMLEGTSGENGEEDFSIDRTNELTQALQAGFFSFLLYYP

Gene-Specific Links for TGME49_082050

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins