ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_080610 ()

signal recognition particle protein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10411

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF13_0350 signal recognition particle receptor alpha subunit
  • PBANKA_114250 signal recognition particle receptor alpha subunit, putative
  • PY04912 similar to RIKEN cDNA 1300011P19 gene
  • PVX_115290 signal recognition particle receptor, putative
  • PCHAS_114200 signal recognition particle receptor alpha subunit, putative
  • PKH_110400 signal recognition particle receptor alpha subunit, putative
  • TGME49_080610 signal recognition particle protein, putative
  • NCLIV_019540 signal recognition particle protein, putative
  • cgd8_5260 Srp101p GTpase. signal recognition particle receptor alpha subunit
  • Chro.80600 signal recognition particle receptor alpha subunit
  • CMU_011790 signal recognition particle receptor subunit alpha, putative
  • TP02_0423 signal recognition particle receptor alpha subunit, putative
  • TA13100 signal recognition particle receptor alpha subunit, putative
  • BBOV_III005280 SRP54-type protein, GTPase domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_080610 signal recognition particle protein, putative
MIDAICAFSRGGVVLWSFCFAKVPSSPFDHLIKNVLLEERSGSCSATLSPYTLQWKFLNNLEIVFVVIYRGIAQLAFLDA
LLDHTALAFVKHMDGKNALDFVASPPSTSFDEVFVKLFTCLHQQQKEKKMQVKAGGRSGGYKAKKKGGAALKLGLGRFLL
FRDASAAIFAIGCVCVFRLTAALWSLDFERFSPFLKPAFSKKSPHGELPNGDDAVARMERATYGADEALEESEDEEELLE
VEMNEEAAAASGWFRSLTSKLQSFTGNKLLTNADIAEVLPAFRAHLAEKNVAEEVIDLLLHSVQSRLKGTRTASFTSVHQ
TVRMAMRDAIVKILTPKKTVDVLRLALEAKAEGRVFSIVFLGVNGVGKSTNLAKVAYYLKHKGNLDVLIAACDTFRAGAV
EQLRTHSRCLQVPLFERGYGKDAAAIAREALATARQEGRDVVLIDTAGRMQDNEPLMRSLAKLVAMNSPDMILFVGEALV
GNDAVDQLKKFNQALVDLTALGGRPPRTVDGIILTKFDTVDDKVGAALSMVYITGQPVVFVGTGQKYPNLKKLNPTMVVK
ALLD

Gene-Specific Links for TGME49_080610

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins