ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_080490 ()

ubiquitin conjugation factor, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12142

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF08_0020 ubiquitination-mediated degradation component, putative
  • PBANKA_070410 ubiquitination-mediated degradation component, putative
  • PY00518 hypothetical protein
  • PVX_089035 ubiquitin conjugation factor E4, putative
  • PCHAS_093390 ubiquitination-mediated degradation component, putative
  • PKH_050430 ubiquitination-mediated degradation component, putative
  • TGME49_080490 ubiquitin conjugation factor, putative
  • NCLIV_019660 ubiquitin conjugation factor, putative
  • cgd3_2410 ubiquitin-fusion degadation-2 (UFD2) family protein with a UBOX at the C-terminus
  • Chro.30281 hypothetical protein
  • CMU_001050 U-box domain-containing protein
  • TP01_0808 hypothetical protein
  • TA05765 ubiquitination-mediated degradation component, putative
  • BBOV_IV009610 U box domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_080490 ubiquitin conjugation factor, putative
MQDSPQSSAAACGAAATIGPAKEDHFLQLVLRLTVDATTASTPHCQLYYLKRYAEELTREGKPLKLARADLETILIKRIQ
DAAKEGTPNVFRFLADCFHRANDEVYSKGLPAALRPGVVQELQRQLVDYSVLLLSCPELFELGDPPPYAMLGEQLTQFVE
MGCPLSFFARMVDTLVQQGTETGEDFLGRWFTPTIKSLSERLNLHSMTEYKSAPLNALKFLSSQKAVARLMADPAILLPE
FPRRFPVTKPGLFYQENSLLGRLLAQTLLDGPTLKNGRQESLSMKYFAGNQALTTQYLQATVQTLRHDEQNHQEVFLQIV
KNLCRGGSDCRHRVVQWYGQILGSNELRAKMSHMLRMTQQQAAESLDPMHSMLLKVQGQTSYGFTLNAFWSLLGLAEPIK
MDKLSDLCYFFCLRGDAVAREVLGDLAKDAKLGNEASVSAAEKFCNAKGVLKAETKFPSEVFWLALKAVRVLFNPCMAEF
TRILQKFQSVHDQGASPTSPEYRFLVAEILSWRTVILHPKFCSLYWHLVHLGLSWLLRAVYCFNLDGSCRLDEETLSVKP
PRLATLVMQSCPPPLQVERQRAARANASGSQSPNHAANASQDVTTPPQFAALPSALVEDLFSSIRRMLELQSVYLSVRSS
QGFEQPPIAAMDAELVASACIAVMTASDFFRNVHLRCDGACKTLYFMFLTEGVRDRLESIPVVQEHLVRALTEVFIASER
GSYYDRITFRIPIVDLFQKLLVVDNYKEALHRLGSSSPEKFIHMIHLLLNDVSTLVDQAMSALTEIRKRQHEGRDHDEPP
QPSATTEGAAAEAAAAAAGASPSRSSSSGTEDEEDEEEDDAGASLEGNAQLRRETWSRLEATTRDLCSLGFNACSLFSLY
AKECGAYIIRSSSILPQAVTTLDCCLDHLVGPRCLQLKVNNMESYNFQPKKWLMKVLESYVYLLQADPEGGDSLVAEILK
DGRYFQKETVNKAYRIAKREGLMNLKLLEKFQELVKRLSEGKEEDFEIDLDAFPAEYLDPIMADVMTDPVKLPTSNNIMD
RKHIERHLMSDPSDPFNRMPLTKDELIPLPELRKEIMDFIATQQKAKAT

Gene-Specific Links for TGME49_080490

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins