ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_079390 ()

proliferation-associated protein 2G4, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11564

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0261 proliferation-associated protein 2g4, putative
  • PBANKA_101630 proliferation-associated protein 2g4, putative
  • PVX_085125 proliferation-associated protein 2g4, putative
  • PCHAS_101710 proliferation-associated protein 2g4, putative
  • PKH_132225 proliferation-associated protein, putative
  • TGME49_079390 proliferation-associated protein 2G4, putative
  • NCLIV_038400 Methionine aminopeptidase (EC 3.4.11.18), related
  • cgd3_2390 proliferation-associated protein 2G4 metalloprotease, creatinase/aminopeptidase fold
  • Chro.30278 nuclear DNA-binding protein G2p -related
  • CMU_001090 proliferation-associated protein 2G4, putative
  • TP01_0364 proliferation-associated protein 2g4, putative
  • TA21055 proliferation-associated protein 2g4, putative
  • BBOV_IV005570 proliferation-associated protein 2g4, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_079390 proliferation-associated protein 2G4, putative
MLKPVDAQLCISEKEFSCSPLHRKFSRQPTRASAVDSLGKYSLQNSHSFPILSDIATMADATGSEVETEVVQDLSNPDVV
TKYRTAADIVNGALKKVICGCVPGADVYALCKTGDTYIVEACSKVYNKKENGKKMEKGIAFPTCISINEICGHFSPVEEN
AETDRVLAEGDVVKVDLGCHIDGYIAVVAYTVVCDASLPGIFGGTSGAQEQGRITGRKADVIKACWTAAEACMRLVKAGH
KSTDLTKTIELAAKQYGCTPLQGVLSHQLKRYVIEGSKCFADATPGPGEDEPEEFEFEPNEVYGVDIVISSGEGKAKDAA
VKPTVYKRAVDRTYILKSQLGRHFMSEVQNKYPTLPFSLRGFSDDRACKVGVAEAMRHELLHPYPVMTEKPGEYVAQFKF
TLLLLPTGTKKVTGLPLLYEKELDSIHTVEDESLKALLAVSVNPKKLKKKAQVEKREDANNA

Gene-Specific Links for TGME49_079390

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins