ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_078830 ()

glucose-6-phosphate dehydrogenase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10590

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0511 glucose-6-phosphate dehydrogenase-6-phosphogluconolactonase
  • PBANKA_131750 glucose-6-phosphate dehydrogenase-6- phosphogluconolactonase, putative
  • PY00793 Glucose-6-phosphate dehydrogenase, putative
  • PVX_117790 glucose-6-phosphate 1-dehydrogenase, putative
  • PCHAS_132080 glucose-6-phosphate dehydrogenase-6- phosphogluconolactonase, putative
  • PKH_125270 glucose-6-phosphate dehydrogenase-6-phosphogluconolactonase, putative
  • TGME49_078830 glucose-6-phosphate dehydrogenase, putative
  • NCLIV_067180 Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49), related
  • NCLIV_068740 Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49), related
  • TA05220 glucose-6-phosphate-1-dehydrogenase, putative
  • BBOV_IV001600 glucose-6-phosphate dehydrogenase-6-phosphogluconolactonase
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_078830 glucose-6-phosphate dehydrogenase, putative
MYLPSKIGQKGDEVDKMKSANEEASPSGSSSGRSTKSPGVFPTFSVAAIPPRAAVSSLATRGIFDLSERPKEISCRNDDA
FVAHGAYLLFNAIKRKLTESSYAKVVIGLSGGSTPLPIYSALRHLALASADHEPGRAATHLATAVPEFSEELQRDAKGSD
SALDWTRVFFFLVDERYVHPTHADSNQRSIRKHLLGQPNGVACDQPGAECGGDVLPVPEKNLIFPDTSLPLEDCIVKYRS
ALLELLAATQQIDLVTLGLGPDGHIASIFPPLSEEDLKEQMNPNPIVLHTTTSRFAGFDRITVSLQLLCGAHQKVFFLKG
DEKIRLWRDMQDDARSKSVAEFPALAVLQSGNVKVVAVPPLDVHEEHLQQQLRADRTFLSVVVLGASGDLAHKKTYPALF
SLFCEGLLPPHFHIVGYARSKMTFDQFWEKISQKLKSLSSFFCRRASAIDLLASFKSHCSYLQGLYDRPADFANLGNHLK
EVEGDAEQVGRVLYLALPPDVFLPSVKSYRQSCWNTKGWNRVVVEKPFGRDLKSSDKLSASLMALLREREIFRIDHYLGK
EMSLSLTALRFANVAFMPLFHRDYVHSVRITFKEQSGTWRRGGYFDNYGIIRDVMQNHMIQLLTLVAMERPASLKDDDIR
DEKVKVLKQMPPVKISETVLGQFTKSVDGQLPGYTDDDTVPKDSKTPTFCTCVLWINNERWSGVPFIFKAGKALESKTTE
VRVQLREAPAGASFFHEPNLTPNELVILVQPHEAVYLKIHTKKPGLLSQGLQPTELDLSVMDRFDVERLPDAYERLLLDV
IRGDKQNFVRTDELREAWRIFTPLLHEIEEKNIDPLPYPAGSSGPSASYDLIQKYYSYKQSNYKWTPPKRETSSDTVQ

Gene-Specific Links for TGME49_078830

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins