ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_078530 ()

multiprotein bridging factor type 1, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11324

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF11_0293 multiprotein bridging factor type 1, putative
  • PBANKA_092000 multiprotein bridging factor type 1, putative
  • PY05916 multiprotein bridging factor type 1
  • PVX_092030 multiprotein bridging factor type 1, putative
  • PCHAS_092440 multiprotein bridging factor type 1, putative
  • PKH_092610 multiprotein bridging factor type 1, putative
  • TGME49_078530 multiprotein bridging factor type 1, putative
  • NCLIV_067470 hypothetical protein
  • cgd3_3750 multiprotein bridging factor type 1 like transcriptional co-activator
  • Chro.30426 multiprotein bridging factor type 1
  • CMU_031900 multiprotein bridging factor 1 domain-containing protein
  • TA17395 multiprotein bridging factor (type 1), putative
  • BBOV_I000130 multiprotein bridging factor type 1
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_078530 multiprotein bridging factor type 1, putative
MSFQDWTPVSWNKTGQRQKGVTKEQEINQARRRGEELETEKKFLGGQNKATKGGLCPNARKIEEDTGDYHVERVSADFSR
ALQQARQAKKMTQAELAQAINEKPSVVNDYESGRAIPNGAVVQKLNRALGVSLPKAKEKRKPVA

Gene-Specific Links for TGME49_078530

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins