ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_078050 ()

proteasome subunit alpha type 1, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11294

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0716 proteosome subunit alpha type 1, putative
  • PBANKA_130140 proteosome subunit alpha type 1, putative
  • PY00267 proteasome subunit alpha type 1
  • PVX_118620 proteosome subunit alpha type 1, putative
  • PCHAS_130460 proteosome subunit alpha type 1, putative
  • PKH_126890 proteosome subunit alpha type 1, putative
  • TGME49_078050 proteasome subunit alpha type 1, putative
  • NCLIV_067980 Proteasome subunit alpha type (EC 3.4.25.1), related
  • cgd2_2050 proteasome subunit alpha type 1, NTN hydrolase
  • Chro.20222 proteasome A type subunit
  • CMU_036920 proteasome subunit alpha type 1, putative
  • TP02_0927 proteasome subunit alpha type 1, putative
  • TP02_0930 proteasome subunit alpha type 1, putative
  • TA15875 proteasome subunit alpha type 1, putative
  • TA15900 proteasome subunit alpha type 1, putative
  • BBOV_IV000320 proteasome subunit alpha type 1
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_078050 proteasome subunit alpha type 1, putative
MYRNLYDTDCITWSPQGRIFQVEYAMEAVKQGTCCVGLRSNTHVVLCSLKRAVSKFAGHHQKLFKIDDHVGVAMSGITAD
AKVISNFMRNECFHHKYVYDAPIPVGRLVLMVADKSQANTQRSGKRPFGVGLLAAGYDDAGPHLFETCPSGNYFESYAMA
FGARSQSSKTYLERNFENFPGLSPEELELHAMKALQASLAADAELTADTVSMAIVGKNQPWKELSTDEVQSLLDKLNAES
AGEDVQM

Gene-Specific Links for TGME49_078050

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins