ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_077970 ()

dolichol-phosphate mannosyltransferase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10812

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PY00944 dolichol phosphate mannose synthase
  • PVX_092685 dolichyl-phosphate b-D-mannosyltransferase, putative
  • PCHAS_070860 dolichyl-phosphate b-d-mannosyltransferase, putative
  • PKH_093900 dolichyl-phosphate b-d-mannosyltransferase, putative
  • TGME49_077970 dolichol-phosphate mannosyltransferase, putative
  • NCLIV_068040 hypothetical protein
  • cgd5_2040 dolichol phosphate mannose synthase, putative
  • Chro.50175 dolichyl-phosphate b-D-mannosyltransferase
  • CMU_039780 glycosyl transferase, group 2 family protein
  • TP02_0741 dolichol-phosphate mannosyltransferase, putative
  • TA14850 dolichol phosphate mannose synthase, putative
  • BBOV_III011210 glycosyl transferase, group 2 family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_077970 dolichol-phosphate mannosyltransferase, putative
MTRYSVILPAYNERENIPYMVWMLVDAFKKNHLDFEILLVDDSSPDGTAAAYKELQKIFRGERLLLLERPGKLGLGSAYA
DGLKKTTGDFIILMDADFSHHPKFIPEFIKKQKEGDFDVVTGSRYIKGGGVCGWDAKRIIISRGANFLAQTLLNPRVSDL
TGSFRLFKRNALENIMTRIISKGYVFQMEVAVRARELGYSIGEVPITFVDRIYGESKLGGNEIWQYLKGLLTLFWTI

Gene-Specific Links for TGME49_077970

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins