ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_077500 ()

26S proteasome AAA-ATPase subunit RPT1, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11292

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF13_0063 26S proteasome regulatory subunit 7, putative
  • PBANKA_141000 26S proteasome regulatory subunit 7, putative
  • PY02805 26S proteasome subunit P45 family, putative
  • PVX_122410 26S proteasome ATPase subunit, putative
  • PCHAS_141190 26S proteasome regulatory subunit 7, putative
  • PKH_141040 26S proteasome regulatory subunit 7, putative
  • TGME49_077500 26S proteasome AAA-ATPase subunit RPT1, putative
  • NCLIV_068380 hypothetical protein
  • cgd6_4350 26S proteasome regulatory subunit 7 (RPT1)-like. AAA atpase
  • Chro.60498 26S proteasome ATPase subunit
  • CMU_020410 26S proteasome regulatory subunit 7, putative
  • TP01_0711 26S proteasome regulatory subunit 7, putative
  • TA06255 26S proteasome subunit, putative
  • BBOV_IV009940 26S protease regulatory subunit 7, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_077500 26S proteasome AAA-ATPase subunit RPT1, putative
MANHKETEPPHAPEAAERPKAKKDAAHEDEEPKKTIPLDDADINILKSYGLSPYAFAIKRLDTDIKSLTEKITKLCGVRE
SDTGLCQPSQWDLAADKQLMQEQPLQVARCTKIIYPGGQTRGGENGENGESGGAGTTAPPPFGGDDEEPKYIINVKQIAK
FVVGLGEKVAAMDIEEGMRVGVDRNKYKIQIPLPPKIDPTVTMMTVEEKPDVTYNDVGGAKEQLEKLREVLELPLLHPER
FLSLGIDPPKGVLLYGPPGTGKTLTARAVANRTDACFICVIGSELVQKYVGEGARMVRELFQMARSRRACILFIDEVDAI
GGSRGGEGEGNAHGDHEVQRTMLEIVNQLDGFEARGNIKVLMATNRPDTLDPALLRPGRLDRKVEFGLPDLEGRTHIFKI
HAKTLSVDRNIRYELLARLCPNSTGADIRSVCTEAGILAIRARKKSISEKNFIDAINRVIKGYKKFSATAKYMVYN

Gene-Specific Links for TGME49_077500

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins