ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_077240 (NTPase, NTP1)

nucleoside-triphosphatase I, a gene from Toxoplasma gondii

Compiled localisation
during not sporozoite 2 hours post inoculation and not sporozoite 6 hours post inoculation and not sporozoite
dense granule during bradyzoite and merozoite and sporozoite 12 hours post inoculation and sporozoite 18 hours post inoculation and tachyzoite
parasite plasma membrane and parasitophorous vacuole membrane during tachyzoite
parasitophorous vacuole during bradyzoite and merozoite and tachyzoite
not rhoptry during merozoite and tachyzoite
oocyst wall during bradyzoite

Who localised this protein by microscopy?

Ferguson, D. J., Henriquez, F. L., Kirisits, M. J., Muench, S. P., Prigge, S. T., Rice, D. W., Roberts, C. W., McLeod, R. L.
Maternal inheritance and stage-specific variation of the apicoplast in Toxoplasma gondii during development in the intermediate and definitive host. (2005 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

dense granule and parasitophorous vacuole during merozoite
  • "These staining combinations assisted in the identification of the various developmental stages, with the ENO2 strongly labeling the active nuclei of the trophozoites and early- to mid-stage schizonts and also the cytoplasm of the macrogametocyte and with the anti-NTPase localizing to the parasitophorous vacuole and the dense granules within mature merozoites (10, 14)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PV and dense granule during merozoite
  • Comment: strain information ambiguous
  • Other genes localised in this publication: enoyl-acyl carrier reductase, SRS29B (= SAG1, P30), bradyzoite antigen, putative, enolase 2

Ferguson, D. J.
Use of molecular and ultrastructural markers to evaluate stage conversion of Toxoplasma gondii in both the intermediate and definitive host. (2004 Mar 9, Int J Parasitol) PubMed / full text
   more detail about this publication

parasitophorous vacuole during merozoite and tachyzoite, oocyst wall during bradyzoite, dense granule and not rhoptry during merozoite

Kikuchi, T., Furuta, T., Kojima, S.
Membrane localization and demonstration of isoforms of nucleoside triphosphate hydrolase from Toxoplasma gondii. (2001 Jan, Parasitology) PubMed / full text
   more detail about this publication

parasite plasma membrane during tachyzoite
  • "The findings suggested that NTPase recognized by 6C6 antibody was localized on the surface membrane of tachyzoites of T. gondii."
  • Microscopy type: EM
  • Microscopy method: monoclonal antibody
  • Strain: RH
  • Gene model mapping comments: Blast from L39077, annotation matches
  • Localisation record: surface during tachyzoite
  • Comment: strain information not found
  • Other genes localised in this publication: -

Ferguson, D. J., Cesbron-Delauw, M. F., Dubremetz, J. F., Sibley, L. D., Joiner, K. A., Wright, S.
The expression and distribution of dense granule proteins in the enteric (Coccidian) forms of Toxoplasma gondii in the small intestine of the cat. (1999 Mar, Exp Parasitol) PubMed / full text
   more detail about this publication

dense granule and parasitophorous vacuole during bradyzoite and merozoite and tachyzoite, not rhoptry during merozoite and tachyzoite, during not sporozoite

Ferguson, D. J., Jacobs, D., Saman, E., Dubremetz, J. F., Wright, S. E.
In vivo expression and distribution of dense granule protein 7 (GRA7) in the exoenteric (tachyzoite, bradyzoite) and enteric (coccidian) forms of Toxoplasma gondii. (1999 Sep, Parasitology) PubMed / full text
   more detail about this publication

dense granule and parasitophorous vacuole during merozoite
  • "Using double labelling, it could be shown that GRA7 co-localized with the NTPase in both the PV and merozoite cytoplasm (Fig. 1 M)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: M3, RRA
  • Gene model mapping comments: inferred from another publication
  • Localisation record: dense granule and PV during merozoite
  • Other genes localised in this publication: dense granule protein 7, hypothetical protein

Tilley, M., Fichera, M. E., Jerome, M. E., Roos, D. S., White, M. W.
Toxoplasma gondii sporozoites form a transient parasitophorous vacuole that is impermeable and contains only a subset of dense-granule proteins. (1997 Nov, Infect Immun) PubMed / full text
   more detail about this publication

during not sporozoite 2 hours post inoculation and not sporozoite 6 hours post inoculation, dense granule during sporozoite 12 hours post inoculation and sporozoite 18 hours post inoculation
  • "NTPase is first detected as intracellular granular staining +/-12 h postinfection and is only secreted in PV2, not PV1."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: VEG
  • Gene model mapping comments: inferred from another publication
  • Localisation record: not during sporozoite 2 hours post inoculation, not during sporozoite 6 hours post inoculation, dense granule during sporozoite 12 hours post inoculation, dense granule during sporozoite 18 hours post inoculation
  • Other genes localised in this publication: dense granule protein 1 / major antigenp24, 28 kDa antigen, hypothetical protein, dense granule protein 5 precursor

Bermudes, D., Peck, K. R., Afifi, M. A., Beckers, C. J., Joiner, K. A.
Tandemly repeated genes encode nucleoside triphosphate hydrolase isoforms secreted into the parasitophorous vacuole of Toxoplasma gondii. (1994 Nov 18, J Biol Chem) PubMed / full text
   more detail about this publication

parasitophorous vacuole and parasitophorous vacuole membrane during tachyzoite
  • "By immunofluorescence, the NTPase is located in vesicular structures within the parasite, and in infected cells it is secreted into the vacuolar space and becomes partially associated with the parasitophorous vacuolar membrane."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PVM and PV during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48021

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_077240 nucleoside-triphosphatase I
MWLPVYVPLLLVFGVSLSLPQGSLGTDSSSLRGVDADTEKRINVGKKHLQTLRNLETRCHDSLQALVVIDAGSSSTRTNV
FLAKTRSCPNKGRSIDPDSIQLIGAGKRFAGLRVVLEEWLDTYAGKDWESRPVDARLLFQYVPQMHEGAKKLMQLLEEDT
VAILDSQLNEKQKVQVKALGIPVMLCSTAGVRDFHEWYRDALFVLLRHLINNPSPAHGYKFFTNPFWTRPITGAEEGLFA
FITLNHLSRRLGEDPARCMIDEYGVKHCRNDLAGVVEVGGASAQIVFPLQEGTVLPSSVRAVNLQRERLLPERYPSADVV
SVSFMQLGMASSAGLFLKELCSNDEFLQGGICSNPCLFKGFQQSCSAGEVEVRPDGSASVNEDVRKNRLKPLATYCSVNN
PEISFKVTNEMQCRENSIDPTKPLAERMKIENCSIIEGTGNFDKCVSQVESILVAPKLPLPANIEAASSGFESVDQVFRF
ASSTAPMIVTGGGMLAAINTLKDHRLLRSDFSGDVEELAEAAREFCSSEVIIRTDGPVIQLPNARGEQKLNSLNFDLCKT
MALTVSLLRHMAAGENQPSFIKWEKSIAGPDGKPLADLGWQVGVILHHVLFTEEWGRTAYEAGYSHNL

Gene-Specific Links for TGME49_077240

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins