ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_077080 (MIC5)

microneme TgMIC5 protein, a gene from Toxoplasma gondii

Compiled localisation
microneme during intracellular tachyzoite
not dense granule and not rhoptry during intracellular tachyzoite

Who localised this protein by microscopy?

Harper, J. M., Zhou, X. W., Pszenny, V., Kafsack, B. F., Carruthers, V. B.
The novel coccidian micronemal protein MIC11 undergoes proteolytic maturation by sequential cleavage to remove an internal propeptide. (2004 Aug, Int J Parasitol) PubMed / full text
   more detail about this publication

microneme during intracellular tachyzoite
  • ""
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during intracellular tachyzoite
  • Other genes localised in this publication: MIC2-associated protein M2AP, microneme protein MIC11

Brydges, S. D., Sherman, G. D., Nockemann, S., Loyens, A., Daubener, W., Dubremetz, J. F., Carruthers, V. B.
Molecular characterization of TgMIC5, a proteolytically processed antigen secreted from the micronemes of Toxoplasma gondii. (2000 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme and not dense granule and not rhoptry during intracellular tachyzoite
  • "Ultrathin sections stained with MαM5 showed immunogold particles clustered over the micronemes with no significant staining of other secretory organelles such as rhoptries or dense granules"
  • Microscopy type: Light and EM
  • Microscopy method: antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from CAA70921, annotation matches
  • Localisation record: microneme and not rhoptries and not dense granule during intracellular tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_116288

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_077080 microneme TgMIC5 protein
MIWGCFLRHVFGLSVLVWVLDVVSVSRETVKPKAQFHLHRVCKREPVFLYSRVTMLRPTVRSSLLSLGLTVILYLALTGS
ADALASHLRSRHMEAGRRTMDTQNDVESAGRQSEPMEAADRQAEHPGAPTQSEMKEFQEEIKEGVEETKHEGDPEMTRLM
VTEKQESKNFSKMAKSQSFSTRIEELGGSISFLTETGVTMIELPKTVSEHDMDQLLHDILAAGGVVGLDSEVKLA

Gene-Specific Links for TGME49_077080

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins