ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_076140 (ADP ribosylation factor 1, ARF1) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

ADP ribosylation factor 1, a gene from Toxoplasma gondii

Compiled localisation
golgi apparatus during extracellular tachyzoite and intracellular tachyzoite

Who localised this protein by microscopy?

Liendo, A., Stedman, T. T., Ngo, H. M., Chaturvedi, S., Hoppe, H. C., Joiner, K. A.
Toxoplasma gondii ADP-ribosylation factor 1 mediates enhanced release of constitutively secreted dense granule proteins. (2001 May 25, J Biol Chem) PubMed / full text
   more detail about this publication

golgi apparatus during extracellular tachyzoite and intracellular tachyzoite
  • "TgARF1-HA Localizes to the Golgi/TGN by Immunofluorescence and Immunoelectron Microscopy--"
  • Microscopy type: Light, EM
  • Microscopy method: C terminal HA tag, polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from AF227524, gene model inconsistent
  • Localisation record: golgi during intracellular tachyzoite and extracellular tachyzoite
  • Comment: RACE was done, suggesting the toxodb gene model is too long
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10155

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_076140 ADP ribosylation factor 1
MGLSVSRLWSRLFGKREMRILMVGLDAAGKTTILYKLKLGEVVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH
YFSNTHGLIFVIDSNDRDRIEDAREELHRMLNEDELRDAVLLIFANKQDLPNAMTAAEVTDKLHLHSIRHRNWFIQSTCA
TTGDGLYEGLDWLSRTLAQKNID

Gene-Specific Links for TGME49_076140

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins