ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_076130 (CPC2) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

cathepsin C2 (TgCPC2), a gene from Toxoplasma gondii

Compiled localisation
dense granule during tachyzoite

Who localised this protein by microscopy?

Que, X., Engel, J. C., Ferguson, D., Wunderlich, A., Tomavo, S., Reed, S. L.
Cathepsin Cs are key for the intracellular survival of the protozoan parasite, Toxoplasma gondii. (2007 Feb 16, J Biol Chem) PubMed / full text
   more detail about this publication

dense granule during tachyzoite
  • "TgCPC1 and TgCPC2 localize to constitutive secretory vesicles of tachyzoites, the dense granules."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from DQ063594.1, annotation matches, gene model inconsistent
  • Localisation record: dense granule during tachyzoite
  • Comment: No localisation data shown in the paper. Why not?
  • Other genes localised in this publication: cathepsin C

Orthology

OrthoMCL

Part of OrthoMCL group OG4_28077

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_076130 cathepsin C2 (TgCPC2)
MSAAVEPRGRLSDGCCRRRLTPAAVLFLCRVLVLFWVNEAEPANGDLPAHCLVKHVLGEWEIQEGLWLPCQEEGNLTTDA
ARLHDPYCGYGIPDRVDAHGPMTPPNVSASFHALRTSRFTLFPDFRIEFEDGSSGLWTLVYDEGLHFEVSTPQNRRFFAF
FKYQLAPDGQNRAWSYCHTTLVGWWERPAAPNLSLQDVEKAPPVYDIPEPIAPDTAADALLKSVKRGCWWGRKVGEDLSV
PTNEVPKERRTPLEVPLWPTSRPPDVRTVAAVVRKNLAADAPWEPLDEEYVEIRGRKLRTMEEVWAHAGHQPLLISRQNI
ESTHLTLSVRPPLHLLAGIKPFGSPAGSDPPWRTVRDFDWANEDHVALRIGRRQSVIPDAPNQGGCGSCYAIATGTVLTS
RLWIRYAANDDVFGKVNVSAFQGTSCNVYNQGCGGGYVFLALKFGQEHGFRTEDCVSEYHAMADKHKGSLSPNLQTCFDL
GGQLGTSAFGCQAPPARASLPDSCNLSVKVTSWHYVGGVYGGCSEDDMLRTLWEHGPMAASIEPTIAFTVYKKGVFRAAY
NSLVEQGDNWVWEKVDHAVVISGWGWAKHGDSWLPYWKVRNSWGTKWGEGGYARVLRGVNEMAIERVAVVGEVSLFRGGE
HIPPLLARSLDSQGSSNASKDSERGETLVESVSPVFRGSASGSESGNPRDAATNESADMSESADADAESSSGSDDDEDGD
MEKGDVESTTKQTTLFRPIQRHGEVLEEKRTGE

Gene-Specific Links for TGME49_076130

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins