ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_075670 (IMC15) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

hypothetical protein, conserved, a gene from Toxoplasma gondii

Compiled localisation
apical cap and basal complex and daughter inner membrane complex and mature cortical inner membrane complex and novel localisation at apical cap during intracellular tachyzoite

Who localised this protein by microscopy?

Anderson-White, B. R., Ivey, F. D., Cheng, K., Szatanek, T., Lorestani, A., Beckers, C. J., Ferguson, D. J., Sahoo, N., Gubbels, M. J.
A family of intermediate filament-like proteins is sequentially assembled into the cytoskeleton of Toxoplasma gondii. (2011 Jan, Cell Microbiol) PubMed / full text
   more detail about this publication

apical cap and basal complex and daughter inner membrane complex and mature cortical inner membrane complex and novel localisation at apical cap during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_20687

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_075670 hypothetical protein, conserved
MCTTPCSSTDDRCTSRRSIYGTPQIQTFSASSAGTQAYIRPLGQSSRSVSPWQSALAPASSAVSSTETTHGIGIYATQSQ
QASHVRVTGGVDSILGPSAPAPTVSSPSHIPAFSQSSCGSTNSAPGNGQSTWCQTSPVTVGGQANASAQVKIAQAPAAAS
SQPNYSRAKTTQAVVEQKMVPEGYDRVEHMVPRLRPVSVVENRIEIPVVKVVDTIVHKQKIEERIRFVDKPVVQEVEKFV
EVPEVIYSDVIVEVPEIVEVIKHVPKEEIRENITYVPRFETKIIPKYVDVPIIKIVDRYEEVHEIHEVLKPVAKVKVVDV
PKEFTRIVPKYSVHKTKSKVSVPDIQYKEVPRYRMRYEPKILRDTVINHIPQYLDIEVPYEVPKVTVVDQPFFVTTYRDH
QYPVPVSHSVTPVLLPGDHTQVVDVPVEKPYVVVHDKFTPRPPIPELIPGQAVLRGVTHLDKERLTAEQQAVHSTAYGSQ
HSWTVLVLRAYKKFRSLVPDDAKMHSGPTEFVEGIKQVVSFLVAKSAKPRQTPNSVVISVLSENAIHDLVQKL

Gene-Specific Links for TGME49_075670

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins