ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_075440 (GRA6)

granule antigen protein GRA6, a gene from Toxoplasma gondii

Compiled localisation
dense granule during bradyzoite and extracellular tachyzoite and sporozoite and tachyzoite
parasitophorous vacuole during tachyzoite
during not merozoite and sporozoite
oocyst wall during tachyzoite
not parasitophorous vacuole during bradyzoite and merozoite and sporozoite
tubular structure in parasitophorous vacuole during bradyzoite and tachyzoite
not dense granule and outer membrane of cyst wall and parasitophorous vacuole membrane during bradyzoite

Who localised this protein by microscopy?

Ferguson, D. J.
Use of molecular and ultrastructural markers to evaluate stage conversion of Toxoplasma gondii in both the intermediate and definitive host. (2004 Mar 9, Int J Parasitol) PubMed / full text
   more detail about this publication

dense granule and tubular structure in parasitophorous vacuole during bradyzoite and tachyzoite, outer membrane of cyst wall and parasitophorous vacuole membrane and not dense granule during bradyzoite, during sporozoite and not merozoite

Carey, K. L., Donahue, C. G., Ward, G. E.
Identification and molecular characterization of GRA8, a novel, proline-rich, dense granule protein of Toxoplasma gondii. (2000 Jan 5, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

dense granule during tachyzoite
  • "We have generated two monoclonal antibodies (MAbs 17.9 and A3.2) against Toxoplasma gondii, both of which localize to the dense granules of tachyzoites by immunoelectron microscopy. MAb 17.9 is directed against GRA6, a previously described 32 kDa dense granule protein. MAb A3.2 is directed against a novel 38 kDa dense granule protein, which we refer to as GRA8. GRA8 is released into the parasitophorous vacuole during or shortly after invasion and associates with the periphery of the vacuole."
  • Microscopy type: Light and EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: dense granule during tachyzoite
  • Other genes localised in this publication: dense granule protein GRA8

Labruyere, E., Lingnau, M., Mercier, C., Sibley, L. D.
Differential membrane targeting of the secretory proteins GRA4 and GRA6 within the parasitophorous vacuole formed by Toxoplasma gondii. (1999 Aug 20, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

dense granule during extracellular tachyzoite
  • "GRA2, GRA4 and GRA6 are colocalized in dense granules"
  • Microscopy type: EM
  • Microscopy method: antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: dense granule during extracellular tachyzoite
  • Other genes localised in this publication: 28 kDa antigen, hypothetical protein

Ferguson, D. J., Cesbron-Delauw, M. F., Dubremetz, J. F., Sibley, L. D., Joiner, K. A., Wright, S.
The expression and distribution of dense granule proteins in the enteric (Coccidian) forms of Toxoplasma gondii in the small intestine of the cat. (1999 Mar, Exp Parasitol) PubMed / full text
   more detail about this publication

during not merozoite, dense granule during bradyzoite and sporozoite and tachyzoite, oocyst wall and parasitophorous vacuole during tachyzoite, not parasitophorous vacuole during bradyzoite and merozoite and sporozoite

Lecordier, L., Moleon-Borodowsky, I., Dubremetz, J. F., Tourvieille, B., Mercier, C., Deslee, D., Capron, A., Cesbron-Delauw, M. F.
Characterization of a dense granule antigen of Toxoplasma gondii (GRA6) associated to the network of the parasitophorous vacuole. (1995 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

dense granule and parasitophorous vacuole during tachyzoite
  • "GRA6 is detected in the dense granules of tachyzoites, and in the parasitophorous vacuole, closely associated to the network."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from L33814, annotation matches
  • Localisation record: dense granule and parasitophorous vacuole during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115770

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_075440 granule antigen protein GRA6
MAHGGIYLRQKRNFCPLTVSTVAVVFVVFMGVLVNSLGGVAVAADSGGVRQTPSETGSSGGQQEAVGTTEDYVNSSAMGG
GQGDSLAEDDTTSDAAEGDVDPFPALANEGKSEARGPSLEERIEEQGTRRRYSSVQEPQAKVPSKRTQKRHRLIGAVVLA
VSVAMLTAFFLRRTGRRSPQEPSGGGGGNDAGNNAGNGGNEGRGEGGEDDRRPLHPGSVNEFDF

Gene-Specific Links for TGME49_075440

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins