ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_075300 ()

Rhoptry kinase family protein ROP2B (incomplete catalytic triad), a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_29109

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • TGME49_075300 Rhoptry kinase family protein ROP2B (incomplete catalytic triad)
  • NCLIV_001950 Rhoptry protein ROP7 (EC 2.7.11.12), related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_075300 Rhoptry kinase family protein ROP2B (incomplete catalytic triad)
WNVNERFLSNANHLVSTALWRNEQSFRVESELGERPRTLVRGPVLRDDGSYICLEATDQETGESFEVHVPYFMKRPPSNA
IKQMKEEVLRLRLLRGIKNQKQAKVHLRFIFPFDLVKDPKKRKMIRVRLDERDMWVLSRFFLYPRMQSNLQMLGDVLLSH
SSTHKSLVHHARLQLTLQLIRLLASLHHYGLVHADFQVSNILLDQRGGVFLTGFEHLVRDGASAVSPIGRGFAPPETTAE
RMLPFGQHHPTLMTFAFDTWTLGLAIYWIWCADLPNTDDAALGGSEWIFRSCKNIPQPVRALLEGFLRYPKEDRLLPLQA
METPEYEQLRTELSAALPLYQTDGEPTREGGAPPSGTSQPDEAGAAEAVTAI

Gene-Specific Links for TGME49_075300

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins