ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_074060 (OMT)

mitochondrial 2-oxoglutarate/malate carrier protein, putative, a gene from Toxoplasma gondii

Compiled localisation
mitochondrion during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11142

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_070670 oxoglutarate/malate translocator, putative
  • PY02084 putative oxoglutarate/malate translocator protein
  • PVX_089165 mitochondrial 2-oxoglutarate/malate carrier protein, putative
  • PCHAS_071600 oxoglutarate/malate translocator, putative
  • PKH_050710 oxoglutarate/malate translocator protein, putative
  • NCLIV_033680 Solute carrier family 25 (Mitochondrial carrier, dicarboxylate transporter), member 10, related
  • cgd1_600 oxoglutarate/malate translocator protein
  • Chro.10071 oxoglutarate/malate translocator protein
  • CMU_035290 carrier protein, putative
  • TP02_0450 oxoglutarate / malate translocator, putative
  • TA13260 oxoglutarate/malate translocator protein, putative
  • BBOV_III005160 mitochondrial carrier protein family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_074060 mitochondrial 2-oxoglutarate/malate carrier protein, putative
MAASSSAVSGASSSPGSVKKADTFIKRVQPFAVGGLSGCVATTCVQPIDMIKVRIQLAGEAGGSTNPFTVCRNIAKNEGI
SGLYKGLDAGLIRQLTYSTARLGLFRIISDEMRQMEPKDENGVARPLPLWKKAVAGLAAGGLGSFFGNPADLALIRLQAD
ATLPPDQRRNYTGVLNAISRIVKEEGLFGLWRGSTPTVLRAMALNMGMLASNDQAKELLEPAFGKGWTTTLGASAISGFF
AVTFSLPFDFIKTRMQKMRRDPVTGQLPYKNFCDAVVKITRREGIMSLYTGYPTYYVRIAPHAMITLISMEYLNKMWNRY
TSV

Gene-Specific Links for TGME49_074060

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins