ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_073760 (HSP70) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

heat shock protein 70, putative, a gene from Toxoplasma gondii

Compiled localisation
cytoplasm during bradyzoite
mitochondrion during tachyzoite

Who localised this protein by microscopy?

Pino, P., Aeby, E., Foth, B. J., Sheiner, L., Soldati, T., Schneider, A., Soldati-Favre, D.
Mitochondrial translation in absence of local tRNA aminoacylation and methionyl tRNA Met formylation in Apicomplexa. (2010 May, Mol Microbiol) PubMed / full text
   more detail about this publication

mitochondrion during tachyzoite

Weiss, L. M., Ma, Y. F., Takvorian, P. M., Tanowitz, H. B., Wittner, M.
Bradyzoite development in Toxoplasma gondii and the hsp70 stress response. (1998 Jul, Infect Immun) PubMed / full text
   more detail about this publication

cytoplasm during bradyzoite
  • "In vivo bradyzoites in a cyst isolated from a murine brain, demonstrating localization of C92F3A-5 to the cytoplasm of the bradyzoites."
  • Microscopy type: Light, EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: ME49
  • Gene model mapping comments: Blast from AF045559, annotation matches, gene model inconsistent\
  • Localisation record: cytoplasm during bradyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10057

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_073760 heat shock protein 70, putative
MADSPAVGIDLGTTYSCVGVWKNDAVEIIANDQGNRTTPSYVAFTDTERLVGDAAKNQVARNPENTIFDAKRLIGRKFDD
PSVQSDMKHWPFKVIAGPGDKPLIEVTYQGEKKTFHPEEVSAMVLGKMKEIAEAYLGKEVKEAVITVPAYFNDSQRQATK
DAGTIAGLSVLRIINEPTAAAIAYGLDKKGCGEMNVLIFDMGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVD
FCVQDFKRKNRGKDISTNSRALRRLRTQCERTKRTLSSSTQATIEIDSLFEGIDYSVSISRARFEELCMDYFRNSLLPVE
KVLKDSGIDKRSVSEVVLVGGSTRIPKIQQLITDFFNGKEPCRSINPDEAVAYGAAVQAAILKGVTSSQVQDLLLLDVAP
LSLGLETAGGVMTKLIERNTTIPTKKSQTFTTYADNQPGVLIQVYEGERAMTKDNNLLGKFHLDGIPPAPRGVPQIEVTF
DIDANGIMNVTAQDKSTGKSNQITITNDKGRLSASEIDRMVQEAEKYKAEDEQNKHRVEAKNGLENYCYHMRQTLDDEKL
KDKISSEDRDTANKAIQEALDWLDKNQLAEKEEFEAKQKEVESVCTPIITKLYQAGAAAGGMPGGMGGMPGGMGGMPGGM
GGMPGGMGGMPGGMGGMPGAGMGGSGGPTVEEVD

Gene-Specific Links for TGME49_073760

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins