ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_073520 ()

proteasome PCI domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11864

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFE1405c eukaryotic translation initiation factor 3, subunit 6, putative
  • PBANKA_124280 eukaryotic translation initiation factor 3, subunit 6, putative
  • PY01281 hypothetical protein
  • PVX_079840 eukaryotic translation initiation factor 3, subunit 6, putative
  • PCHAS_124320 eukaryotic translation initiation factor 3, subunit 6, putative
  • PKH_100400 Eukaryotic translation initiation factor 3, putative
  • TGME49_073520 proteasome PCI domain-containing protein
  • NCLIV_034130 hypothetical protein
  • cgd2_1500 possible translation initiation factor with possible PINT domain
  • Chro.20164 hypothetical protein
  • CMU_013330 PCI domain-containing protein
  • TP02_0376 eukaryotic translation initiation factor 3 subunit 6, putative
  • TA12845 eukaryotic translation initiation factor 3, subunit 6, putative
  • BBOV_III005760 eukaryotic translation initiation factor 3, subunit 6, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_073520 proteasome PCI domain-containing protein
MVSDSNMANGAAPSQGGLGLIKLMSPYWDSHMSIPVMDWMLSNEMITPEEREQMGQSLLGQAATTPAGRAAVEAEIREIE
AKLVNFNNAIEAYKKEQQKRIGGYPDRKTLVDLSEWWMTNSGQSPAPPALELGVDALVPRLAKLYYDIGDYKQSLQQLQY
MLTTLYELLAEGTNTQTRMACYWGVCACIILLHHQQQSENKSAASEETEKKEAAQDEELLQTLDHGEDEEGDAARAALAE
AAKKAAVETHTAAQCILKLGDILDQVAAASSKKDHQGNPPLPAGLTMSREQQLLNRSWLLHWSVWPLFRYYFLMVHTKQF
IPRNQAWSLMLEWVLHEGNLSCVTVVCPHLLRYYAVYAILNRKRKDHFQAVITAIGQGKNRYSDPFTSLLEALFLDFNFD
EAQHHIARIGEECDSDFFLQPLKGAINEFARLLIFETYCRIHKCINVDMIAKKVNMSPEAAERWIVNLIRHARLEARIDS
EKNRVQMSAAPPNLYQQVIDKTRNLCIRSNLILQNIARPAGFTGREGDDVVTSRTNRQRGGRGRQWVQGGEGDGFYRGEG
GRGGRGGRGDRGHMGDGRRDPMAAVAASMASRRQDDTAFAA

Gene-Specific Links for TGME49_073520

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins