ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_073460 ()

eukaryotic translation initiation factor 3 subunit 6 interacting protein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12098

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFF0590c homologue of human HSPC025
  • PY06519 Drosophila melanogaster RE21692p, putative
  • PVX_113750 Eukaryotic translation initiation factor 3 subunit 6 interacting protein, putative
  • PCHAS_011100 eukaryotic translation initiation factor 3 subunit 6 interacting protein, putative
  • PKH_113670 hypothetical protein, conserved in Apicomplexan species
  • TGME49_073460 eukaryotic translation initiation factor 3 subunit 6 interacting protein, putative
  • NCLIV_034190 eukaryotic translation initiation factor 3 subunit 6 interacting protein, putative
  • cgd2_1160 HSPC021/HSPC025 family protein
  • Chro.20128 RE21692p
  • CMU_009210 hypothetical protein, conserved
  • TP02_0247 hypothetical protein, conserved
  • TA12120 hypothetical protein, conserved
  • BBOV_III003720 conserved hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_073460 eukaryotic translation initiation factor 3 subunit 6 interacting protein, putative
MSGEGQVADAGSLPVEKREEGAQVGHEEDDSLSPDSRFPVSPSNQASQNVEGEGLDDAALDRMMGEKVRFENDVEEFLRS
LYDEVYDRNVDAIRRLYEVEFPALTERYYAERRWPSVDEVGTFYRQFDRYHCLIITLYKELYYRHLFLKCQQEITWEDRR
LAWENYALLINFLAEVECRPDDQKDGKSLRLPLQWLWDILDEFVYQFQEACRWRQRIARRLPEDEEERALFLKEMDKDCD
VWKASPVLEFLHALVQRSEVQDLLRQPKDDATKNKLFESEIRFQLGYFAMILLLRLHVLMGDYFMGVKSVESIELASRGF
YWKVPAAHVTLFYHLGFAYTMMRRYTDAIRVMSQLLVFVSRQRSYLSAHFYQQMAMNKAVDKMYILVMLCASLCNVKLDE
SVNQMIKEKYSDKFYKLQQENDETYCDLFTWACPKFINPATPSFEDPQALERFANSYSEVQLRQCKMFFKEVEFHKKIST
INSFAKLYNNIQLSKLASLMELSDKDPEDAVRSEILSVKYKGRQKVWRSGSLLSGDLTPSSSDNSVEFYMDQDMIHVRSQ
QSQKVYVDQFLKQIERSQHLFNSIQNSARSGQRDNRGQGERGGNQNSEREKFDRSQDRRNYGGHAGASEMPKREQAALA

Gene-Specific Links for TGME49_073460

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins