ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_073450 ()

sufB/sufD domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_15826

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF11_0044 iron-sulfur assembly protein, sufD, putative
  • PBANKA_094350 conserved Plasmodium protein, unknown function
  • PY00907 Uncharacterized protein family UPF0051, putative
  • PVX_090850 hypothetical protein, conserved
  • PCHAS_090080 conserved Plasmodium protein, unknown function
  • PKH_090040 conserved Plasmodium protein, unknown function
  • TGME49_073450 sufB/sufD domain-containing protein
  • NCLIV_034200 sufB/sufD domain-containing protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_073450 sufB/sufD domain-containing protein
MRGAWRRREEGCGGEARLDEHRGNFWRQASALKLSSVHTAQAIMRSGSPFSSRSSVQSASSSFHLSSDCASPVSTSSLLS
SFSEEGERGENATSPHCAMPPPLLDDAGALLPRNASTPFPTLSPFRVSAEARGRLQPQVVDSLTPWKRIVADKFVRTATD
TFIPKHRNFSAHKIGQAAAVQSASAAADLPLVRDAVERAVWAAEKRQEKLMRQRAAEAAGEGENASTEDAAAREEEMRRR
VWRETERHMKSLLGGGTQVDVDDDFHFNDSWLAEGYEDISAEPRFVPPDWTDVPRPCKNSTAITTLTASHLTKPVIDTAD
PRQRNRLRIQYFSPKEKKRQAFWQSLLTVGRESAHSRLSAAHAWLSERHEQQQEEAYKNRRQIGELMILRERRRREKQRE
LEQAGGRYRPPQPPPYPLPLHYLYVNHRLYNAFKLMNVIGWEACLDLPTPHARLEAFRHEHNLRSFYLLPVDDRVSLTAG
IERREAPGKKPKAAQVSNARKRPDANQSSSHHYSVVFSVPDSTSAPSPLHSSSSSSPSSASSSLVVPLRLGDFFLPNMDA
VLVLRDGVIDPQLSRNLEKFGGVEGGEEEVEGAGLLERGMRATFHGDEESTTQRGERNEGERREANESTNDEGTNKDGAG
QTGGGTGGGCCGGSGQKPGGRTPGEGGEEEEPCASHGTQSTQHHGAGNASEDDAEGEEEEAYVGSFLNIRHPGVRSAVAQ
ELQFVPEYSNYWRTNTQPFHRGQIGKTSRKYDSDFAIYDYRKLDFGMAKFSALNLASMQDAACIVVGDDPRYDEKTQEKV
NEEKRARGMAMVDALVAGADKGRRNVDEKRGERGNDVDSGATATSAKNRLWEEGAGSTDRRTAEGAVTQRQEVDRERGRE
EVDQMAKTEQMETPRSAASPGCAEASAATGEKTGMKEKMTLESLIDAIEESQDSRGPEKGIGVEADRQRRKEMKFQVLHL
LTSDLVDLLPYLPPYNHSLPFSSPPPSLSSPPAHPLVNPRLVVHVGRGVNCTLHQTFLSLSDLLPENDQQRLAEAGARQE
MARPAYMRGRGRGGFVNSNTRIVLESDAELHHVYDQEQAIDSWHMENLSVQMGKNSTYVLRQVDLGAQAGRFNLQIEGAE
SSRHTSLGLAVLNGHQEHGKYEMFHHLKPRGETTQIMKSLVGGKARAVWRGRIRIERDGIGTAAESLNRVVLLDEGSRCV
AIPTLEIIPDDVVKPPFDKDMRHHPTCNVTVSSGDTWEAAPQTSSLERLPTRPRIQVTSRYSIKDLK

Gene-Specific Links for TGME49_073450

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins