ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_073090 (Cdc48Cy)

cell division protein 48, putative, a gene from Toxoplasma gondii

Compiled localisation
cytosol during 24 hours after tachyzoite infection

Who localised this protein by microscopy?

Agrawal, S., van Dooren, G. G., Beatty, W. L., Striepen, B.
Genetic evidence that an endosymbiont-derived endoplasmic reticulum-associated protein degradation (ERAD) system functions in import of apicoplast proteins. (2009 Nov 27, J Biol Chem) PubMed / full text
   more detail about this publication

cytosol during 24 hours after tachyzoite infection

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10362

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_111860 cell division cycle protein 48 homologue, putative
  • TP01_0937 cell division cycle protein 48, putative
  • PVX_114095 cell division cycle protein 48 homologue, putative
  • PKH_113000 cell division cycle protein 48 homologue, putative
  • cgd1_330 CDC48 like AAA ATPase ortholog
  • CMU_035010 transitional endoplasmic reticulum ATPase protein, putative
  • Chro.10043 cell division cycle protein 48
  • TA04855 cell divison cycle CDC48 homologue, putative or transitional endoplasmic reticulum ATPase, putative
  • NCLIV_034460 hypothetical protein
  • BBOV_IV008360 cell division control protein 48, putative
  • PVX_088085 cell division cycle ATPase, putative
  • PFF0940c cell division cycle protein 48 homologue, putative
  • NCLIV_004280 hypothetical protein
  • TA06500 transitional endoplasmic reticulum ATPase (CDC48 homologue), putative
  • PY03639 cell division cycle protein 48 homolog
  • PCHAS_111810 cell division cycle protein 48 homologue, putative
  • BBOV_IV001700 cell division cycle protein ATPase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_073090 cell division protein 48, putative
MAGGIRRPQSVPAEKKEESQKKRSPNRLIVEEAINDDNSVVALNPAKMEELQIFRGDTVLLKGKMRHDTVCVVLADQDLD
EGKIRLNKVVRKNLRVKLGDMVHVSACPDCPYGKRIHVLPLDDTIEGITGNLFDIYLKPYFMEAYRPVRKGDLFLVRGGF
RPVEFKESLKIVVGVDPGEFCIVAPDTVIHCEGDPVKREEEERLDEVGYDDIGGCRKQMAQIREMIELPLRHPTLFKTLG
VKPPRGVLLYGPPGSGKTLIAKAVANETGAFFFLINGPEVMSKMAGEAESNLRRAFEEAEKNAPAIIFIDEIDSIAPKRE
KTNGEVERRVVSQLLTLMDGLKGRGQVVVIGATNRQNSIDPALRRFGRFDREIDIGVPDDNGRLEILRIHTRNMKLANDV
KLEELAANTHGFVGADLAQLCTEAALSCIREKMDLIDLEDDTIDAQVLNSMAVTQEHFTSALQCCNPSSLRETVVEVPNV
KWDDIGGLEDVKRNLQEMILYPIDHPEKYEKFGMSPSRGVLFYGPPGCGKTLLAKAVASECSANFVSIKGPELLTMWFGE
SEANVREVFDKARAASPCVLFFDELDSIGTQRGNSLGDAGGAGDRVMNQMLTEIDGVGPMKNLFFIGATNRPELLDEALL
RPGRLDQLIYIPLPDLPARISILQATLRKAPVAKNVPVPFLAQKTAGFSGADLAELCQRAAKAAIRDAIAAEELAQVNAG
ADEMDAEEEEKTDIVYEITRKHFEEGLAGARRSVSQTDLTKYDNFRMKFDPLYKSQAAGGETQVLIEWPDDANDASGGIA
GDDADDDDLYS

Gene-Specific Links for TGME49_073090

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins