ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_072910 ()

TCP-1/cpn60 family chaperonin, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11368

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • MAL13P1.283 TCP-1/cpn60 chaperonin family, putative
  • PBANKA_113410 TCP-1/cpn60 chaperonin, putative
  • PY02937 chaperonin containing TCP-1 delta subunit
  • PVX_114865 T-complex protein 1, delta subunit, putative
  • PCHAS_113360 TCP-1/cpn60 chaperonin, putative
  • PKH_111320 TCP-1/cpn60 chaperonin family, putative
  • TGME49_072910 TCP-1/cpn60 family chaperonin, putative
  • NCLIV_034530 TCP-1/cpn60 family chaperonin, putative
  • cgd5_1880 conserved probable chaperonin containing TCP-1 delta subunit
  • Chro.50193 chaperonin containing TCP-1 delta subunit
  • CMU_039950 TCP-1/cpn60 chaperonin family protein
  • TP01_0241 chaperonin 60 kDa, putative
  • TA19585 chaperonin containing tcp-1 delta subunit, putative
  • BBOV_IV005030 T-complex protein 1 delta subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_072910 TCP-1/cpn60 family chaperonin, putative
MAAADVATKSGGSKPSAGKHDGMWAHDEKQKDIRRQNIIAAKAVADAVRTSLGPRGMDKMIQGPRGDVLITNDGATILNE
MAVVHPVAKMMVELSKAQDVEAGDGTTSVVVLCGALLEASQQLLDRGVHPQLIASSFLEASKQSEKILREMAVPVDLKDR
EKLIQIAATSLQSKVVSHNAKLLAPIAVDAVMKVLPEGKDVDNVDLNDIRVVKKLGGTVDESELVKGIVMVEQKVSKRAG
GPSRIQNAKIGLIQFCLSAPKTDMENNIVIKDYTAMDRMLREERILIAKMVKQIAATGCNVLLIQKSILRDAVNDLSLDY
LAKAKIMVVQNIEREDVEFISRTLGCQPVASLDHFTADKLGHADLAQDEMVAGGGHIVRITGVNAKNTVTVLLRASNNLM
LDETERSLHDALCVVRCLVKRRQLLPGGGAVEAELSLRLNEWARTLPGVQQLCVRMYAEALELIPYTLAENAGLSPLEIV
TDLKLKHAQGEKLVGINVRQGCVSSMVDINVLQPLLVSSSAVKLATEAVMMILKIDDIVMCR

Gene-Specific Links for TGME49_072910

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins