ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_072500 (ST2)

sugar transporter, putative, a gene from Toxoplasma gondii

Compiled localisation
parasite plasma membrane during intracellular tachyzoite

Who localised this protein by microscopy?

Blume, M., Rodriguez-Contreras, D., Landfear, S., Fleige, T., Soldati-Favre, D., Lucius, R., Gupta, N.
Host-derived glucose and its transporter in the obligate intracellular pathogen Toxoplasma gondii are dispensable by glutaminolysis. (2009 Aug 4, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

parasite plasma membrane during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10128

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_072500 sugar transporter, putative
MHPDEGNSPPERMVQTAPSGVSPAPVTDSETDDDASRRSVRRSTRDDTEADIWPDGSLPTSDARGRKRRDWFSGLWHSYA
SAKLDAPAMPDSGLVLEISSSVDPPLSSRPVETGMGSKRIRKWNLSASRKSKTNGEDVTTKTAFTPMIYLVVSFTSLTGL
LMGYDLCVVAVVLSEIQRHFNLCGGAFSCMAKSMFVSVLAPGAAVGSVLGGWMSDRVGRKPGLALSDICLLLGSVAMGTG
EAFWVMLLGRFLIGMGVGLGFVVYATYTSEVSPPDRRGQIVAFQEVAQCFGCLVAYATAACFGEDTWRYLLGMGGIVAGV
QVLGEIFILPETPRFFIQKGHDGRAAASLRKLGITDEAEVARIIEELKADRDSLQDEIGASNAASANTRWRSCLQKFQGK
CKNAVNRFRRHHKSLFIAVGCAVAQNMTAANSVIYFTVDIFRLAGVCNPLIPGVGVGVVKFVGVVVCILFVDRWGRRSLL
LTGTAGTLICLILMATGFALQGEGTAEAAQAACAAADGTNAGISASAKLLISTLLFYIYFWNMSWAALMFVVASEVLPTR
IRGFGMGLTITTFWLLSFVVQSSLEPLFSAVTIPGTFGLFAFLNFLALLFVIFVVPEGKGRSLEDVQRNQVSLKSLSRGP
GCPQVGAPQKAKDTEE

Gene-Specific Links for TGME49_072500

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins